PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G234800.1 | ||||||||
Common Name | PHAVU_007G234800g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 166aa MW: 18477.8 Da PI: 5.2681 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 162.9 | 4.5e-51 | 4 | 100 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqd+++Pianv rim+k+lP +akis++aketvqecvse+isf+t+ea+d+cqre+rkt++++d+lwa+++lGf++y+++l+vyl++yr Phvul.007G234800.1 4 VREQDQYMPIANVLRIMRKILPPHAKISDEAKETVQECVSEYISFITAEANDRCQREQRKTVTAEDVLWAMGKLGFDEYAQSLSVYLTRYR 94 69***************************************************************************************** PP NF-YB 92 elegek 97 + ege+ Phvul.007G234800.1 95 QSEGER 100 ***997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.3E-47 | 3 | 104 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.57E-35 | 7 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.6E-25 | 10 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-15 | 38 | 56 | No hit | No description |
PRINTS | PR00615 | 1.2E-15 | 57 | 75 | No hit | No description |
PRINTS | PR00615 | 1.2E-15 | 76 | 94 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MAGVREQDQY MPIANVLRIM RKILPPHAKI SDEAKETVQE CVSEYISFIT AEANDRCQRE 60 QRKTVTAEDV LWAMGKLGFD EYAQSLSVYL TRYRQSEGER MSVRPASTSA PPFEMNPPYP 120 PYPHGFGMFD YDPSQSIASS SRAAGGFVPN FDPYANPPKP TGGNM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-52 | 4 | 95 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G234800.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007145389.1 | 1e-121 | hypothetical protein PHAVU_007G234800g | ||||
Swissprot | Q84W66 | 4e-53 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | V7BK21 | 1e-120 | V7BK21_PHAVU; Uncharacterized protein | ||||
STRING | XP_007145389.1 | 1e-121 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 1e-55 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G234800.1 |
Entrez Gene | 18626822 |