PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G165100.1 | ||||||||
Common Name | PHAVU_007G165100g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 152aa MW: 17047 Da PI: 5.3391 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.5 | 5.1e-55 | 38 | 133 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 +eqdr+lPianv+rimk++lP nakisk+a+et+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl+kyre Phvul.007G165100.1 38 KEQDRLLPIANVGRIMKQTLPPNAKISKEARETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHKYRE 128 89***************************************************************************************** PP NF-YB 93 legek 97 lege+ Phvul.007G165100.1 129 LEGER 133 **997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-53 | 33 | 140 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.23E-40 | 40 | 141 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.9E-28 | 43 | 107 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.5E-20 | 71 | 89 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 74 | 90 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.5E-20 | 90 | 108 | No hit | No description |
PRINTS | PR00615 | 1.5E-20 | 109 | 127 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MGDNINIGKV LDREGFKYSF TSSTATASDT SEQDGVIKEQ DRLLPIANVG RIMKQTLPPN 60 AKISKEARET MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDICWALATL GFDDYAEPLK 120 RYLHKYRELE GERANQNKGN SYENNNIANI Y* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 37 | 128 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 37 | 128 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G165100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007144547.1 | 1e-111 | hypothetical protein PHAVU_007G165100g | ||||
Swissprot | O82248 | 5e-61 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | V7BJ21 | 1e-109 | V7BJ21_PHAVU; Uncharacterized protein | ||||
STRING | XP_007144547.1 | 1e-110 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-62 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G165100.1 |
Entrez Gene | 18626103 |
Publications ? help Back to Top | |||
---|---|---|---|
|