PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G163100.1 | ||||||||
Common Name | PHAVU_007G163100g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 175aa MW: 19020.2 Da PI: 6.12 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.2 | 1e-57 | 26 | 121 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+yv+plk+yl+ yre Phvul.007G163100.1 26 REQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYVDPLKIYLASYRE 116 89***************************************************************************************** PP NF-YB 93 legek 97 +eg++ Phvul.007G163100.1 117 IEGDS 121 ***97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-54 | 22 | 133 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-40 | 28 | 131 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.0E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.2E-20 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.2E-20 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 4.2E-20 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MADAPASPGG GGSHESGEHS PRSNFREQDR FLPIANISRI MKKALPANGK IAKDAKETVQ 60 ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF EEYVDPLKIY LASYREIEGD 120 SKGSAKGGET SSKRDVYPNP NVQLAHQGSF SQGVNYTNSQ PQGPHMIVPM QGQE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-48 | 24 | 116 | 1 | 93 | NF-YB |
4awl_B | 5e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-48 | 24 | 116 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G163100.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015041 | 5e-99 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007144526.1 | 1e-129 | hypothetical protein PHAVU_007G163100g | ||||
Swissprot | Q8VYK4 | 3e-81 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | V7BG12 | 1e-127 | V7BG12_PHAVU; Uncharacterized protein | ||||
STRING | XP_007144526.1 | 1e-128 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 1e-79 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G163100.1 |
Entrez Gene | 18626083 |
Publications ? help Back to Top | |||
---|---|---|---|
|