PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.007G065600.1 | ||||||||
Common Name | PHAVU_007G065600g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 111aa MW: 12777.7 Da PI: 9.4555 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 94.2 | 5.8e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+ + rqvtfskRrng+lKKA+ELSvLCda+vavi+f+++g+lye+ss Phvul.007G065600.1 9 KKIEDATSRQVTFSKRRNGLLKKAYELSVLCDAQVAVIVFAQNGRLYEFSS 59 68***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.2E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.104 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.4E-32 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.13E-42 | 3 | 75 | No hit | No description |
Pfam | PF00319 | 4.5E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MVRGKVQMKK IEDATSRQVT FSKRRNGLLK KAYELSVLCD AQVAVIVFAQ NGRLYEFSSC 60 DMSKILERYS QYTKDVPANK LGDDYIQNLE RRRTLFVWES SQDEQFLVVG * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-24 | 1 | 92 | 1 | 91 | MEF2 CHIMERA |
6byy_B | 2e-24 | 1 | 92 | 1 | 91 | MEF2 CHIMERA |
6byy_C | 2e-24 | 1 | 92 | 1 | 91 | MEF2 CHIMERA |
6byy_D | 2e-24 | 1 | 92 | 1 | 91 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.007G065600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007143357.1 | 1e-76 | hypothetical protein PHAVU_007G065600g | ||||
Swissprot | Q9FIS1 | 5e-39 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | V7BFT2 | 2e-75 | V7BFT2_PHAVU; Uncharacterized protein | ||||
STRING | XP_007143357.1 | 4e-76 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.4 | 2e-41 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.007G065600.1 |
Entrez Gene | 18625077 |