| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 60.4 | 3.8e-19 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT+eEd +l+++++ +G ++Wkt+a + g++R++k+c++rw++yl
Phvul.003G222400.1 17 RGAWTPEEDRKLAHCIEIYGAKRWKTVALKSGLNRCGKSCRLRWLNYL 64
89********************************************97 PP
|
| 2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 70 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+ + eE++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
Phvul.003G222400.1 70 RGNISDEEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 115
7899******************.*********.************986 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
| UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
| Publications
? help Back to Top |
- Chen B,Wang X,Hu Y,Wang Y,Lin Z
Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco.
Mol. Biotechnol., 2004. 26(3): p. 187-92
[PMID:15004287] - Paz-Ares J,Ghosal D,Saedler H
Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus.
EMBO J., 1990. 9(2): p. 315-21
[PMID:2303027] - Savage N, et al.
Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
PLoS ONE, 2013. 8(10): p. e75452
[PMID:24130712] - Cheng Y, et al.
Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases.
Elife, 2018.
[PMID:24771765] - Ranocha P,Francoz E,Burlat V,Dunand C
Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
Plant Signal Behav, 2014. 9(11): p. e977734
[PMID:25531128] - Kiefer CS, et al.
Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity.
Development, 2015. 142(5): p. 1022
[PMID:25715402] - Kwak SH,Song SK,Lee MM,Schiefelbein J
TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana.
Plant Signal Behav, 2015. 10(12): p. e1103407
[PMID:26451798] - Zhu Y, et al.
The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development.
Plant Cell, 2017. 29(2): p. 260-276
[PMID:28138017] - Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA
Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana.
Plant J., 2017. 92(2): p. 305-316
[PMID:28771873] - Mira MM, et al.
Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit.
J. Exp. Bot., 2017. 68(20): p. 5653-5668
[PMID:29059380] - Kohanová J, et al.
Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
Ann. Bot., 2018. 122(5): p. 903-914
[PMID:29394308] - Cone KC,Burr FA,Burr B
Molecular analysis of the maize anthocyanin regulatory locus C1.
Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5
[PMID:3025847] - Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H
The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators.
EMBO J., 1987. 6(12): p. 3553-8
[PMID:3428265] - Scheffler B, et al.
Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene.
Mol. Gen. Genet., 1994. 242(1): p. 40-8
[PMID:7904044] - Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
Plant J., 1994. 6(1): p. 21-30
[PMID:7920701] - Singer T,Gierl A,Peterson PA
Three new dominant C1 suppressor alleles in Zea mays.
Genet. Res., 1998. 71(2): p. 127-32
[PMID:9717435]
|
