PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.003G200100.1 | ||||||||
Common Name | PHAVU_003G200100g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 196aa MW: 22483.3 Da PI: 8.2218 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.2 | 3e-16 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W +eEd l +++k++G+g W++I+r g++R++k+c++rw +yl Phvul.003G200100.1 10 KGFWNAEEDSVLTNYIKKHGTGKWNRIPRVTGLKRSGKSCRLRWMNYL 57 688*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 53.9 | 4.2e-17 | 63 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg +++eE++l ++++ +lG++ W++Ia +++ gRt++q+k++w+++l Phvul.003G200100.1 63 RGDFSEEEEDLVLRLHSLLGNR-WSLIAGRIP-GRTDNQVKNFWNTHL 108 899*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.945 | 5 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.17E-29 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.8E-13 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-13 | 11 | 57 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.92E-10 | 13 | 57 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-21 | 13 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.754 | 58 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 2.8E-16 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-16 | 63 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-25 | 65 | 112 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-11 | 66 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0090377 | Biological Process | seed trichome initiation | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MEAYENESKK GFWNAEEDSV LTNYIKKHGT GKWNRIPRVT GLKRSGKSCR LRWMNYLTPD 60 VKRGDFSEEE EDLVLRLHSL LGNRWSLIAG RIPGRTDNQV KNFWNTHLSK KIGVDNKKRR 120 RGCVRAKYVP RAEAEGNCNT GEGDKLVDES WSDDLMELAS MHEAIMRDDF GCTFSFPNAV 180 FDLCTDSFHH SFFGL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-27 | 10 | 112 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.003G200100.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 5e-56 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007155422.1 | 1e-145 | hypothetical protein PHAVU_003G200100g | ||||
Refseq | XP_007155423.1 | 1e-145 | hypothetical protein PHAVU_003G200100g | ||||
Swissprot | Q9SEI0 | 7e-59 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | V7CB52 | 1e-144 | V7CB52_PHAVU; Uncharacterized protein | ||||
STRING | XP_007155422.1 | 1e-144 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 3e-61 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.003G200100.1 |
Entrez Gene | 18635481 |