PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.003G087000.1 | ||||||||
Common Name | PHAVU_003G087000g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 217aa MW: 24156.1 Da PI: 6.5109 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.8 | 8.6e-55 | 52 | 148 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yr Phvul.003G087000.1 52 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYMEPLTMYLHRYR 142 69***************************************************************************************** PP NF-YB 92 elegek 97 eleg++ Phvul.003G087000.1 143 ELEGDR 148 ****98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.6E-51 | 47 | 153 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.38E-38 | 55 | 153 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.3E-26 | 58 | 122 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.6E-17 | 86 | 104 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 89 | 105 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.6E-17 | 105 | 123 | No hit | No description |
PRINTS | PR00615 | 8.6E-17 | 124 | 142 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MESGGFHGYR KLPNTTSPGL KLSVSDMNNV NTSRQVAGDN NHTADESNEC TVREQDRFMP 60 IANVIRIMRK ILPPHAKISD DAKETIQECV SEYISFITGE ANERCQREQR KTITAEDVLW 120 AMSKLGFDDY MEPLTMYLHR YRELEGDRTS MRGESLGKRT IEYAPMGVGV ATAFVPPQFH 180 PNGYYGPAMG AYVAPPNAAS SHHHGMPNTE PNARSM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-62 | 51 | 143 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.003G087000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF533650 | 0.0 | AF533650.1 Phaseolus coccineus LEC1-like protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007154053.1 | 1e-164 | hypothetical protein PHAVU_003G087000g | ||||
Swissprot | Q84W66 | 2e-72 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | V7C785 | 1e-162 | V7C785_PHAVU; Uncharacterized protein | ||||
STRING | XP_007154053.1 | 1e-163 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.1 | 8e-75 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.003G087000.1 |
Entrez Gene | 18634317 |