PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.002G009200.1 | ||||||||
Common Name | PHAVU_002G009200g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 176aa MW: 20454 Da PI: 11.189 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 33.9 | 7e-11 | 73 | 133 | 3 | 63 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 e+++ rr+++NR +ArrsR RK+ +e+L++ + eN++L + l+ l ++ ++++e+ Phvul.002G009200.1 73 EDRKRRRMISNRDSARRSRMRKQRHLENLRNQTNLFRVENRELNSGLQFLLRHYNRVRTEN 133 68899*****************************************999998888888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 3.4E-8 | 69 | 129 | No hit | No description |
SMART | SM00338 | 1.2E-12 | 71 | 135 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.1E-8 | 73 | 133 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.254 | 73 | 136 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.43E-10 | 75 | 126 | No hit | No description |
CDD | cd14702 | 4.35E-15 | 76 | 127 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 78 | 93 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MFSALPASQP FQGNAFPALD YAFTPWDEAQ FLDFNPTSPN PVTSSSASDD PTPTAADQNL 60 ASDQSNRVVS LMEDRKRRRM ISNRDSARRS RMRKQRHLEN LRNQTNLFRV ENRELNSGLQ 120 FLLRHYNRVR TENEWLRSER TLLRQKLADI NQILLFRQLQ PFSTAWPCNI GRMNL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 74 | 78 | RKRRR |
2 | 87 | 94 | RRSRMRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.002G009200.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015043 | 1e-169 | AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007156692.1 | 1e-125 | hypothetical protein PHAVU_002G009200g | ||||
TrEMBL | V7CIH8 | 1e-124 | V7CIH8_PHAVU; Uncharacterized protein | ||||
STRING | XP_007156692.1 | 1e-124 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5435 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22850.2 | 3e-23 | basic leucine-zipper 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.002G009200.1 |
Entrez Gene | 18636566 |