PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.001G174600.1 | ||||||||
Common Name | PHAVU_001G174600g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 211aa MW: 23396.4 Da PI: 7.5031 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 186.4 | 2.1e-58 | 51 | 148 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yr Phvul.001G174600.1 51 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYR 141 69***************************************************************************************** PP NF-YB 92 elegekk 98 e+eg++k Phvul.001G174600.1 142 EMEGDTK 148 ****975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.3E-55 | 48 | 165 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.47E-41 | 54 | 157 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.1E-28 | 57 | 121 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-20 | 85 | 103 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 88 | 104 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.2E-20 | 104 | 122 | No hit | No description |
PRINTS | PR00615 | 2.2E-20 | 123 | 141 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
QIRVSSFFQF CHAFHRLFLS QIRVPANMAD GPSSPGGGSH ESGDHSPRSN VREQDRYLPI 60 ANISRIMKKA LPANGKIAKD AKETVQECVS EFISFITSEA SDKCQREKRK TINGDDLLWA 120 MATLGFEDYI DPLKIYLTRY REMEGDTKGS AKGGETSAKK DVQPNPNAQL AHQGSFSQGV 180 SYTNSQVTIL SLFDVLSSFF LFFWAVNVEC * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-46 | 52 | 142 | 3 | 93 | NF-YB |
4awl_B | 9e-47 | 52 | 142 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 9e-47 | 52 | 142 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 8e-47 | 51 | 142 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-47 | 51 | 142 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.001G174600.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 1e-123 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007162720.1 | 1e-158 | hypothetical protein PHAVU_001G174600g, partial | ||||
Swissprot | Q67XJ2 | 1e-81 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | V7CX89 | 1e-157 | V7CX89_PHAVU; Uncharacterized protein (Fragment) | ||||
STRING | XP_007162720.1 | 1e-157 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53340.1 | 4e-82 | nuclear factor Y, subunit B10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.001G174600.1 |
Entrez Gene | 18641716 |
Publications ? help Back to Top | |||
---|---|---|---|
|