PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.J692100.4.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 93aa MW: 9876.01 Da PI: 7.8335 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 100 | 1.7e-31 | 25 | 80 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 +v+Y eC++NhAa++Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FHRreve Pavir.J692100.4.p 25 HVHYWECQRNHAAAIGGYAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVEA 80 689*************************9.999*********************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 3.0E-29 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 5.0E-21 | 26 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 6.6E-26 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.608 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MGPQQDRRRS MANGTAARKE TKVVHVHYWE CQRNHAAAIG GYAVDGCREF MASGAEGTAA 60 ALMCAACGCH RSFHRREVEA ADLDCSSTTT SG* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.J692100.4.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ726979 | 6e-54 | KJ726979.1 Zea mays clone pUT3680 ZF-HD transcription factor (ZHD10) gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025808589.1 | 2e-52 | mini zinc finger protein 1-like | ||||
Refseq | XP_025827869.1 | 2e-52 | mini zinc finger protein 1-like | ||||
Swissprot | B8BIU8 | 4e-32 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
Swissprot | Q2RB28 | 4e-32 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
TrEMBL | A0A270R7F7 | 4e-51 | A0A270R7F7_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7CJK8 | 5e-51 | A0A2T7CJK8_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J13295.1.p | 6e-62 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 1e-30 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.J692100.4.p |
Publications ? help Back to Top | |||
---|---|---|---|
|