PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.J515900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 140aa MW: 15888.4 Da PI: 10.3243 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.1 | 1.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ g+ R+ k+c++rw +yl Pavir.J515900.1.p 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.4 | 1e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++v++ +lG++ W++Ia++++ Rt++++k++w+++l Pavir.J515900.1.p 67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.042 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.08E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.8E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.42E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-24 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.4E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.74 | 66 | 116 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.4E-13 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.10E-9 | 69 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY 60 LRPGIRRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKHQ 120 AIGAIFAPPP PSEPSSIIPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-26 | 12 | 116 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.J515900.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728308 | 1e-170 | KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004978476.1 | 9e-99 | transcription factor MYB30 | ||||
Swissprot | B3VTV7 | 4e-83 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | K3ZJ98 | 2e-97 | K3ZJ98_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J27229.1.p | 1e-100 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 6e-84 | myb domain protein 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.J515900.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|