PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.J339500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 125aa MW: 13870.7 Da PI: 5.4816 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 78.3 | 1.2e-24 | 38 | 96 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k++++++d+ +++++sw e+g +fvv+ + ef++++Lp+yFkh+nf+SFvRQLn+Y Pavir.J339500.1.p 38 FLTKTFQLVDDPCTDHVVSWGEDGATFVVWRPPEFSRDLLPNYFKHNNFSSFVRQLNTY 96 9*********************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 3.9E-27 | 28 | 97 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 1.3E-23 | 34 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 1.77E-22 | 37 | 96 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
Pfam | PF00447 | 7.0E-21 | 38 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-15 | 38 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-15 | 76 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-15 | 89 | 101 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MAFLVERCGS GGGEMAVSMD VETSSQSHAA KPVVPAPFLT KTFQLVDDPC TDHVVSWGED 60 GATFVVWRPP EFSRDLLPNY FKHNNFSSFV RQLNTYVSDW LRVCVHVRAS ALDLHCTFIF 120 LTAD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
5d5v_B | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
5d5v_D | 8e-18 | 11 | 112 | 4 | 100 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.J339500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC243249 | 1e-111 | AC243249.1 Panicum virgatum clone PV_ABa094-D05, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025797236.1 | 3e-55 | heat stress transcription factor B-4d-like | ||||
Swissprot | Q7XHZ0 | 1e-44 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
TrEMBL | A0A2T7CC94 | 5e-54 | A0A2T7CC94_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ib01755.1.p | 3e-54 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G46264.1 | 1e-38 | heat shock transcription factor B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.J339500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|