PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.J285300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 125aa MW: 13432.4 Da PI: 7.3451 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 32 | 2.3e-10 | 37 | 79 | 42 | 86 |
TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 ++sW v+++ + + l+ GW++Fv an+L+ gD vF+l+ Pavir.J285300.1.p 37 GNQSWAVTYC--GELKCKKLGPGWRDFVVANRLRIGDAYVFELIT 79 4699*****5..5554456***********************875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 10.616 | 1 | 103 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 7.28E-11 | 9 | 101 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 3.1E-11 | 11 | 101 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 1.53E-9 | 13 | 84 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 1.9E-7 | 37 | 79 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MQFTQLNAVA YSCALEIPSR LHSHLPGSRV PAVLLFGNQS WAVTYCGELK CKKLGPGWRD 60 FVVANRLRIG DAYVFELITP AAGGTGSEGD GKVVFRVQVL RGDLLEEITS RGATSQDPIV 120 IVDN* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.J285300.1.p |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025811196.1 | 1e-47 | B3 domain-containing protein Os06g0112300-like isoform X1 | ||||
Refseq | XP_025811197.1 | 8e-48 | B3 domain-containing protein Os06g0112300-like isoform X2 | ||||
Refseq | XP_025811198.1 | 8e-48 | B3 domain-containing protein Os06g0112300-like isoform X2 | ||||
Swissprot | Q9LHY9 | 3e-25 | Y6112_ORYSJ; B3 domain-containing protein Os06g0112300 | ||||
TrEMBL | A0A3L6RQW6 | 4e-64 | A0A3L6RQW6_PANMI; B3 domain-containing protein | ||||
STRING | Pavir.J32668.1.p | 3e-74 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12046 | 19 | 33 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.J285300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|