PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pavir.9NG620100.1.p

Organism

Panicum virgatum

Taxonomic ID

38727

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

MYB_related

Protein Properties

Length: 132aa MW: 15092.9 Da PI: 8.2477

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.9NG620100.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.2	1.8e-13	22	68	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r+ WT eE+ +++++ +++G g+W+ I+r++ +++t+ q+ s+ qky Pavir.9NG620100.1.p 22 RLFWTIEEHRQFLCGLHMYGRGDWTNISRHFVTTKTPMQVSSHAQKY 68 678*******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.0E-9	15	71	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.93	17	73	IPR017930	Myb domain
SuperFamily	SSF46689	3.66E-16	19	74	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-10	21	71	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	3.9E-13	21	71	IPR006447	Myb domain, plants
CDD	cd00167	9.07E-10	25	69	No hit	No description
Pfam	PF00249	1.6E-10	25	68	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 132 aa Download sequence Send to blast
MVDELSQTQV IIIPEQERRH KRLFWTIEEH RQFLCGLHMY GRGDWTNISR HFVTTKTPMQ 60 VSSHAQKYFR RIEHTTEKQR YNINDVGLYD AERLAAQSNS SSLEALAFAG GANNQNSYGS 120 CSQLATMNNL A*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.9NG620100.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004959144.1	3e-53	transcription factor SRM1
Refseq	XP_025806559.1	5e-54	myb-like protein I
Swissprot	Q8S9H7	4e-21	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A2S3H852	7e-68	A0A2S3H852_9POAL; Uncharacterized protein
STRING	Pavir.J00200.1.p	8e-96	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP842	30	133

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G58900.1	2e-24	Homeodomain-like transcriptional regulator

Link Out ? help Back to Top
Phytozome	Pavir.9NG620100.1.p

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]