PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG547600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 317aa    MW: 34137.7 Da    PI: 7.05
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG547600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Pavir.9NG547600.1.p 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                         788*******************************************97 PP

2Myb_DNA-binding50.45.2e-1667111147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          rg ++++E+ l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Pavir.9NG547600.1.p  67 RGTFSQQEENLIIHLHSLLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                          899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466892.21E-2912108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001673.15E-121761No hitNo description
PROSITE profilePS5129425.71862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2565116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002494.5E-1567111IPR001005SANT/Myb domain
CDDcd001675.56E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIIH LHSLLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKRLRERG  120
IDPATHQPLA EPAVACRAVF GDVVDLIPAT AASLQAPLAE PMPLDGVKLP LDWPVAGAAV  180
PPPSRSSCYL QGGCFDMDAL QQHCGGGAVP ATVVPSASSS STLTSMAEAE HCNNADVAGA  240
GLPWLELGPN AVAVATGHVD SYAGALDELR WSEYFDGAFQ AAASQQGALQ AAGQCVYRGK  300
DDVAVHFDVH GLSNWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-28121165108B-MYB
1h8a_C9e-281111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG547600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365350.0BT036535.2 Zea mays full-length cDNA clone ZM_BFb0120O20 mRNA, complete cds.
GenBankBT0410770.0BT041077.1 Zea mays full-length cDNA clone ZM_BFc0171O14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796264.10.0transcription factor MYB10-like
TrEMBLA0A3L6TF630.0A0A3L6TF63_PANMI; Myb-related protein Zm1-like
STRINGPavir.Ia03281.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.13e-76myb domain protein 50