PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG470700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 214aa    MW: 24251.3 Da    PI: 6.653
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG470700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-143375246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                         gr +++E+ l +++++++G+  W++Iar+++ gRt++++k++w +
  Pavir.9NG470700.1.p 33 GRLSPQEERLAIELHARWGNS-WSRIARRLP-GRTDNDIKNYWKT 75
                         7889***************99.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.4261226IPR017877Myb-like domain
SuperFamilySSF466893.55E-191283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-71238IPR009057Homeodomain-like
PROSITE profilePS5129421.7222781IPR017930Myb domain
SMARTSM007172.4E-133179IPR001005SANT/Myb domain
PfamPF002498.1E-133375IPR001005SANT/Myb domain
CDDcd001671.23E-103675No hitNo description
Gene3DG3DSA:1.10.10.608.4E-183978IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDRAGGHATG LNRTGKSCRL RWVNYLHPSR KHGRLSPQEE RLAIELHARW GNSWSRIARR  60
LPGRTDNDIK NYWKTRMRMK AQERELSMSP SSSSFSLMYQ SSCLLDTAPV DGMSCGDTRD  120
VNVSSCITGS ALECTDGFPM DQIWREMETP LQAPVSMPQG IHQADEKTCS SSVPFSPPAT  180
TASMWDDQCP EVFWNMDPEE IRMLTPQFDC RDW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-15138137105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-15138191159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-15138191159MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-15138160128MYB TRANSFORMING PROTEIN
1mse_C1e-15138137105C-Myb DNA-Binding Domain
1msf_C1e-15138137105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG470700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021316575.11e-120myb-related protein MYBAS1 isoform X2
SwissprotQ53NK63e-70MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLA0A1B6PU491e-118A0A1B6PU49_SORBI; Uncharacterized protein
STRINGPavir.Ia02093.1.p1e-159(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.33e-46myb domain protein 48
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]