PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG468100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family STAT
Protein Properties Length: 625aa    MW: 69662.6 Da    PI: 6.4676
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG468100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT185.66.1e-581452631119
                 STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfei 89 
                          l+vvl+na+g+pv kd+evvasL+yad+g+vveks dd+e+pLLi+++G+e+++ +rpl++++Gra+fklkisqLsskcdn+Lfri+f++
  Pavir.9NG468100.2.p 145 LEVVLINAFGEPV-KDKEVVASLVYADNGMVVEKSrDDSEPPLLITCEGLEYPAISRPLPIIHGRALFKLKISQLSSKCDNKLFRIRFST 233
                          79**********9.*********************9****************************************************** PP

                 STAT  90 pklkkypfleavskpirCisrsrntrsssl 119
                          +++++ypflea+sk i Cisr+r+ r++++
  Pavir.9NG468100.2.p 234 LHMRRYPFLEAYSKTICCISRNRTIRPLGS 263
                          *************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.505.103.2E-5517597IPR000980SH2 domain
SuperFamilySSF555503.32E-7520604IPR000980SH2 domain
PROSITE profilePS5000110.226526624IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MRLHKEAPAT ASSYPWTDTT NLSSTSECPL EKWFHIGCEV TDNVIRLHVN GDLTAEIHLC  60
SLSDEPDHQE DANKISLVGN DSKLEGYMYN IEVSSVLGTI QEQYAKNPPF KLYIDYSSSD  120
GIEECDDGIW NVVGGKASCR RNFILEVVLI NAFGEPVKDK EVVASLVYAD NGMVVEKSRD  180
DSEPPLLITC EGLEYPAISR PLPIIHGRAL FKLKISQLSS KCDNKLFRIR FSTLHMRRYP  240
FLEAYSKTIC CISRNRTIRP LGSGKRVSSA TADETDFLQG LVNADRVNGH SHSHGQSSVA  300
HSHTPKFPKI EGDGMAKVVE TNKILSQNKH ARKMVLSKEA QNAMGTDTST SNFDSFGSGS  360
SWSGSDADDV ETFSDAVVFR YCLDSTYDRS KFLRGAAPTF NKEDLVKLAD QISLYSGCSH  420
HRNQILMSKR FLREGADTWS MISKNNERAL WSSAIPGIIT KFMDIAHSAS RGLSEQDLEV  480
LRGIAGCGED IGRDEFDRLW CWLYPVAATL SRDKIKKLWD CRSPKWIEGF ITIQEAENAL  540
RSSKELLKEP GTFVLRFPTT RSWPHPDAGN LVVTYIGSDN SIHHRLLSLD SSAATAENLQ  600
DLLLQEPELS QLGRVDRLPT AIRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.163170.0callus| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG468100.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795117.10.0SH2 domain-containing protein B-like
TrEMBLA0A3L6TJV80.0A0A3L6TJV8_PANMI; Uncharacterized protein
STRINGPavir.Ia02279.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-149SH2 domain protein B