PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG468100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family STAT
Protein Properties Length: 709aa    MW: 78384.5 Da    PI: 6.3502
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG468100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT185.37.5e-582293471119
                 STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveks.ddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfei 89 
                          l+vvl+na+g+pv kd+evvasL+yad+g+vveks dd+e+pLLi+++G+e+++ +rpl++++Gra+fklkisqLsskcdn+Lfri+f++
  Pavir.9NG468100.1.p 229 LEVVLINAFGEPV-KDKEVVASLVYADNGMVVEKSrDDSEPPLLITCEGLEYPAISRPLPIIHGRALFKLKISQLSSKCDNKLFRIRFST 317
                          79**********9.*********************9****************************************************** PP

                 STAT  90 pklkkypfleavskpirCisrsrntrsssl 119
                          +++++ypflea+sk i Cisr+r+ r++++
  Pavir.9NG468100.1.p 318 LHMRRYPFLEAYSKTICCISRNRTIRPLGS 347
                          *************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498997.28E-633192IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.103.8E-5601681IPR000980SH2 domain
SuperFamilySSF555504.01E-7604688IPR000980SH2 domain
PROSITE profilePS5000110.226610708IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MAAPGSECGG SDGGYRDLRD VRVELDPGTA RGGGGGGFAV CFWLYLSNSA RPSSVILHQV  60
TTGDDNKLPF LALGEGNKLL LFPLMRLHKE APATASSYPW TDTTNLSSTS ECPLEKWFHI  120
GCEVTDNVIR LHVNGDLTAE IHLCSLSDEP DHQEDANKIS LVGNDSKLEG YMYNIEVSSV  180
LGTIQEQYAK NPPFKLYIDY SSSDGIEECD DGIWNVVGGK ASCRRNFILE VVLINAFGEP  240
VKDKEVVASL VYADNGMVVE KSRDDSEPPL LITCEGLEYP AISRPLPIIH GRALFKLKIS  300
QLSSKCDNKL FRIRFSTLHM RRYPFLEAYS KTICCISRNR TIRPLGSGKR VSSATADETD  360
FLQGLVNADR VNGHSHSHGQ SSVAHSHTPK FPKIEGDGMA KVVETNKILS QNKHARKMVL  420
SKEAQNAMGT DTSTSNFDSF GSGSSWSGSD ADDVETFSDA VVFRYCLDST YDRSKFLRGA  480
APTFNKEDLV KLADQISLYS GCSHHRNQIL MSKRFLREGA DTWSMISKNN ERALWSSAIP  540
GIITKFMDIA HSASRGLSEQ DLEVLRGIAG CGEDIGRDEF DRLWCWLYPV AATLSRDKIK  600
KLWDCRSPKW IEGFITIQEA ENALRSSKEL LKEPGTFVLR FPTTRSWPHP DAGNLVVTYI  660
GSDNSIHHRL LSLDSSAATA ENLQDLLLQE PELSQLGRVD RLPTAIRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.163170.0callus| leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9NG468100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795117.10.0SH2 domain-containing protein B-like
TrEMBLA0A3L6TJV80.0A0A3L6TJV8_PANMI; Uncharacterized protein
STRINGPavir.Ia02279.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75473135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-164SH2 domain protein B