PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.9NG432000.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 143aa MW: 15825.9 Da PI: 10.4464 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.5 | 3.8e-15 | 63 | 107 | 5 | 49 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 +r++r++kNRe+A rsR RK+a+++eLe v +Le+e +L e Pavir.9NG432000.1.p 63 QRQKRMIKNRESAARSRDRKQAYVAELESQVTQLEEEQAELLTEQ 107 89************************************9998775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.4E-7 | 59 | 121 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.795 | 61 | 113 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 7.2E-12 | 62 | 113 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 5.08E-14 | 63 | 109 | No hit | No description |
SuperFamily | SSF57959 | 1.97E-11 | 63 | 114 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 5.9E-14 | 64 | 118 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 66 | 81 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MTLEDFLARD SGARAAAAAA AAEGNMALGF PVPDGDAAGA GAGAGRGARK RALVDPADRA 60 VMQRQKRMIK NRESAARSRD RKQAYVAELE SQVTQLEEEQ AELLTEQEER RQQRLKELME 120 RAFPVIRKKL SRDLRRTNSM EW* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.24169 | 0.0 | leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.9NG432000.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004961953.1 | 3e-72 | G-box-binding factor 4 | ||||
Swissprot | Q0JHF1 | 4e-49 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | A0A368QHW4 | 8e-71 | A0A368QHW4_SETIT; Uncharacterized protein | ||||
STRING | Pavir.J36143.1.p | 5e-95 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 5e-14 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.9NG432000.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|