PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.9NG097300.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 244aa MW: 27914 Da PI: 9.7696 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.6 | 1.2e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+iifs++gklyey++ Pavir.9NG097300.2.p 9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIIFSTKGKLYEYAT 59 79***********************************************86 PP | |||||||
2 | K-box | 104.8 | 1e-34 | 78 | 174 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 + s+e++++ ++++e++ Lk+++e++q+ q+hl+GedLe+L+lkeLqqLeqqLe+slk+iRs+K++l++e+i+elq+kek+lqeenk Pavir.9NG097300.2.p 78 KVLISAESETQGNWCHEYRMLKAKVETIQKCQKHLMGEDLETLNLKELQQLEQQLESSLKHIRSRKSQLMMESISELQRKEKSLQEENKI 167 555667888999****************************************************************************** PP K-box 94 Lrkklee 100 L+k+l+e Pavir.9NG097300.2.p 168 LQKELAE 174 ***9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.969 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.80E-42 | 2 | 76 | No hit | No description |
SuperFamily | SSF55455 | 3.53E-34 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.3E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 6.5E-30 | 84 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 17.874 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALIIFST KGKLYEYATD 60 TSMDKILERY ERYSYAEKVL ISAESETQGN WCHEYRMLKA KVETIQKCQK HLMGEDLETL 120 NLKELQQLEQ QLESSLKHIR SRKSQLMMES ISELQRKEKS LQEENKILQK ELAEKQKAQR 180 QQAQWDQTQQ QTSSSSSSFM MREAPPATNI SYPVAAGGRV EGPAAQPQAR IGLPPWMLSH 240 ISS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 5e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 5e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 5e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 6e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 6e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 6e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 6e-25 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.17467 | 0.0 | leaf| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) apical meristem and later in developing stamens, pistil primordia and differentiated anthers. | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in sterile lemmas, at intermediate levels in stamens, and weakly in lemmas, paleas and carpels. {ECO:0000269|PubMed:10444103}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269|Ref.9}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.9NG097300.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ430641 | 0.0 | AJ430641.1 Zea mays mRNA for putative MADS-domain transcription factor (m4 gene). | |||
GenBank | BT085681 | 0.0 | BT085681.1 Zea mays full-length cDNA clone ZM_BFc0047E01 mRNA, complete cds. | |||
GenBank | KJ727509 | 0.0 | KJ727509.1 Zea mays clone pUT5368 MADS transcription factor (MADS4) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004981741.1 | 1e-150 | MADS-box transcription factor 14 isoform X2 | ||||
Swissprot | Q10CQ1 | 1e-135 | MAD14_ORYSJ; MADS-box transcription factor 14 | ||||
TrEMBL | A0A368SEI9 | 1e-147 | A0A368SEI9_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ia00530.1.p | 1e-145 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 4e-75 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.9NG097300.2.p |