PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.9KG609300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 93aa MW: 10350.7 Da PI: 7.3653 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 23.9 | 7.3e-08 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++llP+a +++ ++ a +L+++++YI+sL Pavir.9KG609300.1.p 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRSL 59 789999*********889********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 1.2E-8 | 3 | 79 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 10.683 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 5.63E-9 | 19 | 81 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 4.9E-5 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 93 aa Download sequence Send to blast |
MSSRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRSLH 60 QEMDDLSERL SELLATSDMS SAQAAIIRSL LM* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.16344 | 1e-157 | root| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway (By similarity). {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that acts as a positive regulator of grain size. Binds the transcription repressor APG and forms a heterodimer of antagonistic bHLH transcription factors that regulates grain length and weight by controlling cell elongation in lemma and palea. May be involved in the control of lamina inclination through brassinosteroid signaling pathway. {ECO:0000269|PubMed:22363621}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.9KG609300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004985540.2 | 1e-56 | transcription factor ILI6 | ||||
Refseq | XP_025792689.1 | 1e-56 | transcription factor ILI6 isoform X2 | ||||
Swissprot | B8APB5 | 1e-44 | ILI6_ORYSI; Transcription factor ILI6 | ||||
Swissprot | Q0DUR2 | 1e-44 | ILI6_ORYSJ; Transcription factor ILI6 | ||||
TrEMBL | A0A2T8I693 | 3e-55 | A0A2T8I693_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A368SV83 | 3e-55 | A0A368SV83_SETIT; Uncharacterized protein | ||||
TrEMBL | A0A3L6S9J8 | 3e-55 | A0A3L6S9J8_PANMI; Transcription factor ILI6 | ||||
TrEMBL | K4AH74 | 3e-55 | K4AH74_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ib00456.1.p | 8e-57 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2675 | 33 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 5e-31 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.9KG609300.1.p |