PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG578100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 312aa    MW: 34776.2 Da    PI: 7.0345
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG578100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.11.8e-49101363128
                  NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                          pGfrFhPt+eel+++yL + v+gkkl++ ++i +++iy+++PwdLp+++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+++
  Pavir.9KG578100.1.p  10 PGFRFHPTEEELLDFYLDRMVHGKKLHF-DIIGTLNIYRHDPWDLPAMAKIGEREWYFFVPRDRKAGSGGRPNRTTERGFWKATGSDRAI 98 
                          9*************************99.99***************99999*************************************** PP

                  NAM  93 lsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           s+  +++++glkktLvfy+grap+g+ktdWvm+eyrl
  Pavir.9KG578100.1.p  99 RSSadSKRVIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 136
                          *99877888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-586163IPR003441NAC domain
PROSITE profilePS5100555.578163IPR003441NAC domain
PfamPF023652.7E-2510136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MAMEVEQDLP GFRFHPTEEE LLDFYLDRMV HGKKLHFDII GTLNIYRHDP WDLPAMAKIG  60
EREWYFFVPR DRKAGSGGRP NRTTERGFWK ATGSDRAIRS SADSKRVIGL KKTLVFYQGR  120
APRGTKTDWV MNEYRLPDSG AGSGARAPPP PKEDMVLCKI YRKATPLKEL EQRASAMEEM  180
QRRSNAHYTN TARAPQVQAA ASAGDDYLSS DDAHDSFLFP SSSSSAPLGD NYSPPMEAKQ  240
EADATVTVAS TSLMQAANMA IVPPPAVRHG DLPSLQLPTN HGVLDWMQDL SQLRSPWQDQ  300
FFLSPLAHLL S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-48416310168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.72330.0callus
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.9KG578100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070900.0AK107090.1 Oryza sativa Japonica Group cDNA clone:002-121-G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025795753.10.0NAC domain-containing protein 22
SwissprotQ10S651e-145NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A3L6S6V00.0A0A3L6S6V0_PANMI; NAC domain-containing protein 67-like
STRINGPavir.J24394.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.19e-84NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]