PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.9KG166800.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 95aa MW: 10385.7 Da PI: 9.3975 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 20.6 | 8e-07 | 22 | 61 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L+ llP+a ++ ++ a +L++++ YI+sL Pavir.9KG166800.1.p 22 QISDLVAKLQALLPEARLRSNDRVPSARVLQETCSYIRSL 61 789999*********8899*******************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.280.10 | 6.3E-8 | 5 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 10.074 | 7 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 3.4E-9 | 17 | 83 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MSSRQSRSRA SSGSTSRIKD EQISDLVAKL QALLPEARLR SNDRVPSARV LQETCSYIRS 60 LHREVDDLSD RLSELLATAD VSTAQAAVIR SLLM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.9KG166800.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT836589 | 1e-88 | CT836589.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA333Z79, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004983143.1 | 8e-46 | transcription factor ILI7 | ||||
Refseq | XP_025797606.1 | 8e-46 | transcription factor ILI7 | ||||
Swissprot | A2Z730 | 1e-43 | ILI7_ORYSI; Transcription factor ILI7 | ||||
Swissprot | Q338G6 | 1e-43 | ILI7_ORYSJ; Transcription factor ILI7 | ||||
TrEMBL | A0A2S3IMI6 | 2e-44 | A0A2S3IMI6_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7C6W6 | 2e-44 | A0A2T7C6W6_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6SFA9 | 2e-44 | A0A3L6SFA9_PANMI; Transcription factor ILI7 | ||||
TrEMBL | K4AH62 | 2e-44 | K4AH62_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ib03462.1.p | 7e-58 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2675 | 33 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 4e-33 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.9KG166800.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|