PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.8NG017500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 91aa MW: 9620.69 Da PI: 7.8171 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.6 | 6.2e-33 | 24 | 80 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + v+Y+eC++NhAa++Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FHRreve Pavir.8NG017500.1.p 24 KVVHYRECQRNHAAAIGGYAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVEP 80 5799*************************9.999********************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 1.0E-21 | 24 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 3.0E-30 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 2.9E-26 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.258 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MGPQQDRRSM AANGTAARKE TNNKVVHYRE CQRNHAAAIG GYAVDGCREF MASGAEGTAA 60 ALMCAACGCH RSFHRREVEP DLDCSSTTSA * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.30959 | 1e-149 | root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.8NG017500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU976010 | 2e-60 | EU976010.1 Zea mays clone 508548 zinc finger homeodomain protein 1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025808589.1 | 6e-53 | mini zinc finger protein 1-like | ||||
Refseq | XP_025827869.1 | 6e-53 | mini zinc finger protein 1-like | ||||
Swissprot | B8BIU8 | 4e-33 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
Swissprot | Q2RB28 | 4e-33 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
TrEMBL | A0A270R7F7 | 1e-51 | A0A270R7F7_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J10145.1.p | 1e-60 | (Panicum virgatum) | ||||
STRING | Pavir.J19599.1.p | 1e-60 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 2e-30 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.8NG017500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|