PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.8KG240200.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 176aa MW: 19789.3 Da PI: 9.0355 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.8 | 1e-17 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd lv +++q+G+g+W+++++ g+ R+ k+c++rw +yl Pavir.8KG240200.1.p 15 KGPWTPEEDIVLVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.6 | 1.9e-15 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ +++++ ++lG++ W++Ia++++ Rt++++k++w+++l Pavir.8KG240200.1.p 68 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 113 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.247 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.79E-31 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.7E-13 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.3E-16 | 15 | 62 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 16 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.08E-12 | 17 | 62 | No hit | No description |
SMART | SM00717 | 2.4E-13 | 67 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.148 | 67 | 117 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.0E-13 | 68 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.32E-10 | 70 | 113 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-25 | 70 | 117 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MGRPPCCDNG VGVKKGPWTP EEDIVLVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN 60 YLRPGIKRGN FTPHEEGIII HLQALLGNKW AAIASYLPQR TDNDIKNYWN THLKKKVKRL 120 QQPACDSFQT APPNAVTSPN YYSPTTSSSH HSLQAGLQPT EQLPEHHLHQ CSEQQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-26 | 13 | 117 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.42529 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.8KG240200.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT083881 | 0.0 | BT083881.1 Zea mays full-length cDNA clone ZM_BFb0050H17 mRNA, complete cds. | |||
GenBank | EU955550 | 0.0 | EU955550.1 Zea mays clone 1536772 mRNA sequence. | |||
GenBank | KJ727611 | 0.0 | KJ727611.1 Zea mays clone pUT5518 MYB transcription factor (MYB61) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025826665.1 | 1e-113 | transcription factor MYB30-like | ||||
Swissprot | B3VTV7 | 8e-82 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A2T7CPI9 | 1e-112 | A0A2T7CPI9_9POAL; Uncharacterized protein | ||||
STRING | Si026733m | 1e-111 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 3e-81 | myb domain protein 60 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.8KG240200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|