PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG289500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 364aa    MW: 38567.4 Da    PI: 4.708
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG289500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161663148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Pavir.7NG289500.1.p 16 KGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                         799*****************************99************97 PP

2Myb_DNA-binding55.99.6e-1869114148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T+eE+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Pavir.7NG289500.1.p  69 RGNFTAEEEEAIIKLHAMLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1951163IPR017930Myb domain
SuperFamilySSF466891.09E-3013110IPR009057Homeodomain-like
SMARTSM007172.3E-131565IPR001005SANT/Myb domain
PfamPF002492.8E-151663IPR001005SANT/Myb domain
CDDcd001672.80E-111863No hitNo description
PROSITE profilePS5129425.53364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2767117IPR009057Homeodomain-like
SMARTSM007174.7E-1668116IPR001005SANT/Myb domain
PfamPF002498.1E-1669114IPR001005SANT/Myb domain
CDDcd001671.26E-1271114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNKGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTAEEEEAI IKLHAMLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSP  120
AGEERGAGSK KKKKKAEGAG EPAAPSPSPS SSTTTATTNC SSGDSGEHQS DASKVPDEVG  180
LEELEMIPML DDPAFDFDML VDAVPVPYCP AVSVPTSPCA SSTSPPAPAR PGVDELLDLP  240
EIDIDHELWS IIDGDGGGAC TVAAAGTPPP CQSNATEPNA ASTTSHGAEW WLEDLEKELG  300
LWGPIEDYQC PMGPQGPLAH PDPLPAMVDD PVSCYFQAGP APAVLQDPAA SSAVATSSNQ  360
MGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-29141182105C-Myb DNA-Binding Domain
1msf_C3e-29141182105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114134KKRVSPAGEERGAGSKKKKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.123560.0root
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7NG289500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0701451e-174BT070145.1 Zea mays full-length cDNA clone ZM_BFc0138F01 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025824709.10.0myb-related protein Zm1-like
SwissprotP200241e-106MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A2S3I9V40.0A0A2S3I9V4_9POAL; Uncharacterized protein
STRINGPavir.Gb00587.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.13e-69myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]