PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG264000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 286aa    MW: 30259.7 Da    PI: 6.3018
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG264000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151562148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Pavir.7KG264000.1.p 15 KGLWSPEEDEKLRDFILRHGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
                         678*******************************************97 PP

2Myb_DNA-binding543.9e-1769113248
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          g +++eE+e    +++++G++ W+ Iar+++ gRt++++k++w++yl
  Pavir.7KG264000.1.p  69 GMFSPEEEETVMSLHAKMGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                          569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-211065IPR009057Homeodomain-like
PROSITE profilePS5129413.6121062IPR017930Myb domain
SuperFamilySSF466896.24E-2913109IPR009057Homeodomain-like
SMARTSM007175.7E-111464IPR001005SANT/Myb domain
PfamPF002492.6E-131562IPR001005SANT/Myb domain
CDDcd001671.59E-101862No hitNo description
PROSITE profilePS5129425.66563117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2666116IPR009057Homeodomain-like
SMARTSM007179.9E-1567115IPR001005SANT/Myb domain
PfamPF002499.6E-1669113IPR001005SANT/Myb domain
CDDcd001677.74E-1371113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGCKACQKPK AQYRKGLWSP EEDEKLRDFI LRHGHGCWSA LPAKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSPEEEETVM SLHAKMGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGG  120
AQAKCAADPA TPAGSDVRAG SPNPSDNGQG GGADRPASSD SSGPVESSSA DDSSCLTATE  180
PGAVRPHAPV LPKVIFADWF DMDYGTGLAE LGPDAGVLDA SGRSLSHQGS VQVDGPCGAV  240
GSSLHGLGDG GICWGFDAAA DQMDVQGAGF CDWLSMSEFL GININ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24151187109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.103921e-121root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at very low level. Expressed in cauline leaves. {ECO:0000269|PubMed:11581165}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.7KG264000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0915921e-142FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823961.10.0transcription factor LAF1-like
SwissprotQ9M0K44e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A2S3I9F50.0A0A2S3I9F5_9POAL; Uncharacterized protein
TrEMBLA0A2T7CXV30.0A0A2T7CXV3_9POAL; Uncharacterized protein
STRINGPavir.Ga00879.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-57myb domain protein 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]