PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.6KG286000.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 23313 Da PI: 6.5219 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.7e-16 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + +WT+eEde l +av+++G ++W++Ia + gR +k+c++rw ++l Pavir.6KG286000.1.p 16 KTPWTAEEDEALRRAVREHGRRNWAAIAGAVAGGRGAKSCRLRWCQHL 63 579***************************999***********9986 PP | |||||||
2 | Myb_DNA-binding | 49.8 | 8.2e-16 | 71 | 112 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++T+eEd ++v+ + +G++ W+tIar++ gR+++ +k+rw++ Pavir.6KG286000.1.p 71 PFTPEEDARIVEQQRVHGNK-WATIARYLH-GRSDNAVKNRWNS 112 89******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.587 | 11 | 63 | IPR017930 | Myb domain |
SMART | SM00717 | 4.9E-16 | 15 | 65 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.69E-29 | 15 | 110 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.5E-15 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.01E-6 | 18 | 63 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-21 | 18 | 70 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.376 | 64 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 4.0E-12 | 68 | 116 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.58E-9 | 71 | 111 | No hit | No description |
Pfam | PF00249 | 4.8E-13 | 71 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-20 | 71 | 116 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MAAERGGEGK TDCCRKTPWT AEEDEALRRA VREHGRRNWA AIAGAVAGGR GAKSCRLRWC 60 QHLAPELDSR PFTPEEDARI VEQQRVHGNK WATIARYLHG RSDNAVKNRW NSALRKAQQG 120 SPAAAAQEAA DDAAEDQAAA PACLDLFPLR AGEMREANAA DRLGVREEDK EAEEEDAASI 180 GLTLGSPGLS DAELALSLGP VRPPPNRRVF RLFL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-26 | 16 | 116 | 7 | 106 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.6KG286000.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012616 | 1e-84 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004974756.1 | 1e-102 | transcription factor MYB1 | ||||
Swissprot | Q9SN12 | 2e-39 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A2T7D831 | 1e-103 | A0A2T7D831_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Fa00943.1.p | 1e-152 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 6e-35 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.6KG286000.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|