PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.5NG508900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 177aa MW: 18871.5 Da PI: 10.4035 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 95.2 | 1.2e-29 | 44 | 111 | 3 | 70 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++ Pavir.5NG508900.1.p 44 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPH 111 78*************************************************************99988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 3.0E-27 | 45 | 105 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 29.951 | 45 | 103 | IPR017887 | Transcription factor TCP subgroup |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045962 | Biological Process | positive regulation of development, heterochronic |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MIRGSNLQQA ADEELARKNA AVATSRQWSA QTESRIVRVS RVFGGKDRHS KVKTVKGLRD 60 RRVRLSVPTA IQLYDLQDRL GLNQPSKVVD WLLNAARHEI DKLPPLQFPP HDLMVGHLAP 120 PMPLVHEEKL AHIAAAAALA SDGAKAGQGD VDMYGSGAGG HHLVGGSPAA TTGSWG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 3e-20 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 3e-20 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.24971 | 0.0 | root |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00065 | PBM | Transfer from AT5G60970 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.5NG508900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970217 | 1e-153 | EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds. | |||
GenBank | KJ728008 | 1e-153 | KJ728008.1 Zea mays clone pUT6143 TCP transcription factor (TCP30) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025814168.1 | 6e-98 | transcription factor PCF5-like | ||||
Refseq | XP_025814169.1 | 6e-98 | transcription factor PCF5-like | ||||
TrEMBL | A0A3L6SMS6 | 8e-98 | A0A3L6SMS6_PANMI; Transcription factor PCF5-like | ||||
STRING | Pavir.J15913.1.p | 2e-99 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2490 | 35 | 84 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60970.1 | 9e-42 | TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.5NG508900.1.p |