 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pavir.5NG216400.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
| Family | TALE | ||||||||
| Protein Properties | Length: 145aa MW: 16592.8 Da PI: 8.6933 | ||||||||
| Description | TALE family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 31.2 | 3.7e-10 | 78 | 111 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55
+yp++e++ +LA+ +gL+ +q+ +WF N+R ++
Pavir.5NG216400.1.p 78 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 111
69*****************************985 PP
| |||||||
| 2 | ELK | 34.6 | 4.3e-12 | 31 | 52 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22
ELK++Ll+KYsg+L+ L++EF+
Pavir.5NG216400.1.p 31 ELKEMLLKKYSGCLSRLRSEFL 52
9********************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03789 | 5.0E-9 | 31 | 52 | IPR005539 | ELK domain |
| PROSITE profile | PS51213 | 10.423 | 31 | 51 | IPR005539 | ELK domain |
| SMART | SM01188 | 3.6E-6 | 31 | 52 | IPR005539 | ELK domain |
| PROSITE profile | PS50071 | 12.633 | 51 | 114 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 4.4E-14 | 53 | 118 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.8E-20 | 53 | 122 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-28 | 56 | 116 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.57E-13 | 63 | 115 | No hit | No description |
| Pfam | PF05920 | 1.5E-17 | 71 | 110 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 89 | 112 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MMGSSEDEQC SGDTDVPDIG QEHSSRLADH ELKEMLLKKY SGCLSRLRSE FLKKRKKGKL 60 PKDARTVLLE WWNTHYRWPY PTEEDKVRLA AMTGLDPKQI NNWFINQRKR HWKPSEDMRF 120 ALMEGVAGGS SGTTLYFDTG TIGP* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 46 | 55 | LRSEFLKKRK |
| 2 | 52 | 56 | KKRKK |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pvr.17337 | 0.0 | leaf| root| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693}. | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in globular stage embryo 3 days after pollination (DAP) in a small region just below the center of the ventral portion of the embryo. At coleoptile stages, expressed in the corresponding region of the epiblast and the central part of the embryo, but weakly in the shoot apical meristem (SAM). At the shoot apex differentiation stage, expressed in the cells surrounding the provascular tissue and radicle primordia. In nearly mature embryos (6 DAP), expressed around the basal part of the provascular tissue and radicle, and around the shoot region at the base of the first leaf primordium, and the notch between the SAM and the second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:10488233}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693}. | |||||
| UniProt | Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10488233}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Pavir.5NG216400.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY781901 | 1e-156 | AY781901.1 Saccharum hybrid cultivar Pindar isolate c53a homeobox protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004967561.1 | 1e-105 | homeobox protein knotted-1-like 1 | ||||
| Refseq | XP_025817775.1 | 1e-105 | homeobox protein knotted-1-like 1 | ||||
| Swissprot | A2Y007 | 9e-87 | KNOSA_ORYSI; Homeobox protein knotted-1-like 10 | ||||
| Swissprot | Q7GDL5 | 9e-87 | KNOSA_ORYSJ; Homeobox protein knotted-1-like 10 | ||||
| TrEMBL | A0A2S3HWH0 | 1e-104 | A0A2S3HWH0_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A368R0G5 | 1e-104 | A0A368R0G5_SETIT; Uncharacterized protein | ||||
| TrEMBL | K3XMZ5 | 1e-104 | K3XMZ5_SETIT; Uncharacterized protein | ||||
| STRING | Si003268m | 1e-105 | (Setaria italica) | ||||
| STRING | Sb03g012480.1 | 1e-104 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1698 | 38 | 92 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G08150.1 | 6e-43 | KNOTTED-like from Arabidopsis thaliana | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pavir.5NG216400.1.p |
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|