PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG556600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 279aa    MW: 29618.1 Da    PI: 8.8469
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG556600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP942.9e-2947114370
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                          g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++
  Pavir.5KG556600.1.p  47 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQ 114
                          78*************************************************************99888 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.6E-2748108IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95148106IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MIRSSNLQQA AAAADEELAR KNAAVATSRQ WSAQTESRIV RVSRVFGGKD RHSKVKTVKG  60
LRDRRVRLSV PTAIQLYDLQ DRLGLNQPSK VVDWLLNAAR HEIDKLPPLQ FPPQDLMVGH  120
LAPPMPLAHE EKFAHIAAAA ALTSDGAKPG QQGDVDMDGS GAGGGHHLGR FPGGYHRFMG  180
LNNAFGMVSG AMAPYNSYTG EAWNNSSSVH DGGGGGSQQV AAAAAAHHSP FPSLLSLAPA  240
PHQLVFYSSE ADQQFQVDNL GSQSLSLSSA RAYHDQAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A4e-2053107155Putative transcription factor PCF6
5zkt_B4e-2053107155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.249710.0root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG556600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702170.0EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814168.11e-155transcription factor PCF5-like
RefseqXP_025814169.11e-155transcription factor PCF5-like
TrEMBLA0A3L6SMS61e-160A0A3L6SMS6_PANMI; Transcription factor PCF5-like
STRINGPavir.Ea02793.1.p1e-171(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.15e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5