PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG353100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 320aa    MW: 34578.5 Da    PI: 6.2348
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG353100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.3e-161562148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Pavir.5KG353100.1.p 15 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 62
                         788*******************************************97 PP

2Myb_DNA-binding49.69.2e-1668111146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Pavir.5KG353100.1.p  68 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 111
                          899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4041062IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-231065IPR009057Homeodomain-like
SuperFamilySSF466895.62E-2912109IPR009057Homeodomain-like
SMARTSM007176.8E-131464IPR001005SANT/Myb domain
PfamPF002492.5E-141562IPR001005SANT/Myb domain
CDDcd001679.88E-121862No hitNo description
PROSITE profilePS5129425.07363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-2666117IPR009057Homeodomain-like
SMARTSM007173.9E-1567115IPR001005SANT/Myb domain
PfamPF002492.5E-1468111IPR001005SANT/Myb domain
CDDcd001672.86E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGREAAAAAR PKLRRGLWSP EEDEKLYNHI IRYGVGCWSS VPKLAGLERC GKSCRLRWIN  60
YLRPDLKRGS FSQQEEDLII SLHKILGNRW SQIASQLPGR TDNEIKNFWN SCIKKKLRQR  120
GIDPATHKPL EDDAAAAAAN SGEAPRDDCN KLLPATADDH CGFAMGGASS DPLAPHSPTV  180
SFDPLSVTNV PAMQGSYGAA HSFQPDNLCD YGGAAAYSAA AYTGGGADSS SNSNGTWTCG  240
NAVGGEPMPQ LDMFGREAYH QFDPANKYSP WQQHEAARLH DGIGGAAGFP IRSMSRDLPD  300
SCFDLARSGL EDEFSVDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30111173108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184400.0root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Germinating seed and apical meristem of shoot and root.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.5KG353100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794211e-164HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025817553.10.0myb-related protein Hv33-like
SwissprotP200275e-77MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A3L6R1060.0A0A3L6R106_PANMI; Myb-related protein Hv33-like
STRINGPavir.J18139.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-72myb domain protein 86