PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.5KG118300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 197aa MW: 22302.7 Da PI: 10.8297 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.8 | 1.1e-17 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl Pavir.5KG118300.1.p 25 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 72 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.9 | 2e-17 | 78 | 121 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ Pavir.5KG118300.1.p 78 RGNLTPEEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 121 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.885 | 20 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.8E-31 | 22 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-13 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-23 | 26 | 79 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.09E-10 | 27 | 72 | No hit | No description |
PROSITE profile | PS51294 | 26.281 | 73 | 127 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-15 | 77 | 125 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-16 | 78 | 121 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.1E-24 | 80 | 126 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.46E-11 | 82 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009686 | Biological Process | gibberellin biosynthetic process | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MSQRKGAMAA VTSSKHEEEM MELRRGPWTL EEDNLLMNYI ACHGEGRWNL LARCSGLKRT 60 GKSCRLRWLN YLKPDIKRGN LTPEEQLLIL ELHSKWGNRW SRIAQHLPGR TDNEIKNYWR 120 TRVQKQARQL RVDANSAVFR DAVRCYWMPR LLEKMAATSA AQQVDPAALL HPAHIAAGVG 180 GAAASPAGPR RPARRD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-26 | 22 | 127 | 4 | 108 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves and flowers. {ECO:0000269|PubMed:19529828}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor of phosphate (Pi) starvation-induced genes. Regulates negatively Pi starvation responses via the repression of gibberellic acid (GA) biosynthesis and signaling. Modulates root architecture, phosphatase activity, and Pi uptake and accumulation. {ECO:0000269|PubMed:19529828}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00216 | DAP | Transfer from AT1G68320 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.5KG118300.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (PubMed:16463103). Induced reversibly in response to phosphate (Pi) deficiency but repressed in the presence of Pi, specifically in the leaves. Availability of Pi increases with decreased levels (PubMed:19529828). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19529828}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HF679427 | 0.0 | HF679427.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB21 protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025814736.1 | 1e-123 | transcription factor MYB2-like | ||||
Swissprot | Q9C9G7 | 1e-80 | MYB62_ARATH; Transcription factor MYB62 | ||||
TrEMBL | A0A2S3HXI2 | 1e-121 | A0A2S3HXI2_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ea00660.1.p | 1e-133 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP198 | 38 | 330 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68320.1 | 1e-82 | myb domain protein 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.5KG118300.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|