PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.5KG044800.5.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 265aa MW: 30098.2 Da PI: 9.6414 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.1 | 1.7e-31 | 36 | 85 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Pavir.5KG044800.5.p 36 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 85 79***********************************************8 PP | |||||||
2 | K-box | 100.8 | 1.8e-33 | 104 | 200 | 4 | 100 |
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 s++ ++e +a+++qqe+akL++ i++Lq+++R l+G+ ++++sl++L+q+e +Lek+++kiR++Knell++++e++qk+e +lq++n+ Pavir.5KG044800.5.p 104 SNS-GtVAEVNAQHYQQESAKLRQTINSLQNSNRTLVGDAIQTMSLRDLKQMEVRLEKGISKIRARKNELLYAEVEYMQKREMDLQSDNM 192 333.25999********************************************************************************* PP K-box 93 aLrkklee 100 +Lr+k++e Pavir.5KG044800.5.p 193 YLRSKVAE 200 *****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.221 | 28 | 88 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.3E-41 | 28 | 87 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.47E-46 | 29 | 102 | No hit | No description |
SuperFamily | SSF55455 | 4.45E-33 | 29 | 100 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 30 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-33 | 30 | 50 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-26 | 37 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-33 | 50 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-33 | 65 | 86 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.0E-24 | 113 | 198 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.063 | 114 | 204 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0048443 | Biological Process | stamen development | ||||
GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 265 aa Download sequence Send to blast |
MLNMMADLSC GSSKVKEQPA PTGSSDKPGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY 60 ELSVLCDAEV ALIVFSSRGR LYEYANNSVK ATIERYKKAN SDTSNSGTVA EVNAQHYQQE 120 SAKLRQTINS LQNSNRTLVG DAIQTMSLRD LKQMEVRLEK GISKIRARKN ELLYAEVEYM 180 QKREMDLQSD NMYLRSKVAE NNERGQPPMN MMGAPSTSEY DHMAPYDSRN FLQVNIMQQP 240 QHYSHQLQPT TLQLGYKFNI CSSF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_B | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_I | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3kov_J | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_A | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_B | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_C | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_D | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_I | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
3p57_J | 8e-21 | 29 | 115 | 1 | 90 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.4354 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at early stage of flower development in stamen anlagen before stamen initiation, and at later stage in lodicule and ovule primordia initiation region. {ECO:0000269|PubMed:10945340, ECO:0000269|PubMed:16326928}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in lemmas, paleas and lodicules. {ECO:0000269|PubMed:10945340}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.5KG044800.5.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU960810 | 0.0 | EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025816639.1 | 0.0 | MADS-box transcription factor 3 isoform X2 | ||||
Swissprot | Q40704 | 1e-149 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
TrEMBL | A0A2T7DSJ8 | 0.0 | A0A2T7DSJ8_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ea00226.1.p | 0.0 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-105 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.5KG044800.5.p |
Publications ? help Back to Top | |||
---|---|---|---|
|