PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.4NG331800.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 193aa MW: 22439.8 Da PI: 9.9919 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.9 | 6.3e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s Pavir.4NG331800.2.p 9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 86.1 | 6.9e-29 | 71 | 159 | 1 | 89 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+sL++ eL+ Leq+++++lk++R +K++++ +q+e+ +kk +++ Pavir.4NG331800.2.p 71 YQQAIGTSLWVEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDSLEFDELRGLEQNVDTALKEVRHRKYHVISTQTETYKKKVIRIKT 159 67888999***************************************************************************988775 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.6E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.59 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.17E-41 | 2 | 80 | No hit | No description |
SuperFamily | SSF55455 | 1.31E-36 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.3E-20 | 82 | 156 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 13.328 | 84 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP 60 GTDIKTIFDR YQQAIGTSLW VEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDSLEFDE 120 LRGLEQNVDT ALKEVRHRKY HVISTQTETY KKKVIRIKTS IFQYHHVIPH TLLCIDLLVH 180 FPSQLGNASL KS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 1 | 73 | 1 | 71 | MEF2C |
5f28_B | 2e-17 | 1 | 73 | 1 | 71 | MEF2C |
5f28_C | 2e-17 | 1 | 73 | 1 | 71 | MEF2C |
5f28_D | 2e-17 | 1 | 73 | 1 | 71 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:10394955, ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.4NG331800.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT018998 | 0.0 | BT018998.1 Zea mays clone Contig486.F mRNA sequence. | |||
GenBank | BT039988 | 0.0 | BT039988.1 Zea mays full-length cDNA clone ZM_BFc0056L03 mRNA, complete cds. | |||
GenBank | EU965657 | 0.0 | EU965657.1 Zea mays clone 287776 MADS-box transcription factor 16 mRNA, complete cds. | |||
GenBank | EU966237 | 0.0 | EU966237.1 Zea mays clone 292756 MADS-box transcription factor 16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004966424.1 | 1e-109 | MADS-box transcription factor 16 | ||||
Refseq | XP_025812646.1 | 1e-109 | MADS-box transcription factor 16 | ||||
Swissprot | Q944S9 | 1e-107 | MAD16_ORYSJ; MADS-box transcription factor 16 | ||||
TrEMBL | A0A2S3HGN1 | 1e-108 | A0A2S3HGN1_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7DU70 | 1e-108 | A0A2T7DU70_9POAL; Uncharacterized protein | ||||
TrEMBL | K3XZ63 | 1e-107 | K3XZ63_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Db00185.1.p | 1e-109 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54340.1 | 2e-57 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.4NG331800.2.p |