PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.3NG032400.2.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 23657.5 Da PI: 8.4945 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.9 | 8.7e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +++ +G g+W++ + g+ R++k+c++rw +yl Pavir.3NG032400.2.p 14 KGAWTKEEDQRLVAYIRAHGEGSWRSLPMAAGLQRCGKSCRLRWINYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.4 | 1.4e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEd+l+++++ +lG++ W+ Ia +++ gRt++++k++w+++ Pavir.3NG032400.2.p 67 RGNFTEEEDDLIINLHGLLGNK-WSVIAGRLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.7E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.749 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.87E-30 | 13 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.3E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.06E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.149 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.86E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MGRSPCCEKA HTNKGAWTKE EDQRLVAYIR AHGEGSWRSL PMAAGLQRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDDLIIN LHGLLGNKWS VIAGRLPGRT DNEIKNYWNT HIKRKLLARG 120 IDAKTHRPLS VTAAASPSSR PGQDQLAARS SCSPETSGAC HSSDDDDCGG IDLNLSISPP 180 REPPSPSSSL PTTQEAAGSK TVVDVDVDAS SEKKTKP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-30 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.23094 | 1e-138 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269|PubMed:11080161}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.3NG032400.2.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269|PubMed:11080161}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AM156905 | 1e-130 | AM156905.1 Zea mays mRNA for transcription factor MYB8 (myb8 gene). | |||
GenBank | EU963911 | 1e-130 | EU963911.1 Zea mays clone 274019 hypothetical protein mRNA, complete cds. | |||
GenBank | HQ858692 | 1e-130 | HQ858692.1 Zea mays clone UT1148 ZmMYB8 transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025807180.1 | 1e-116 | myb-related protein 308-like | ||||
Swissprot | Q9SZP1 | 1e-84 | MYB4_ARATH; Transcription repressor MYB4 | ||||
TrEMBL | A0A3L6T2R3 | 1e-129 | A0A3L6T2R3_PANMI; Myb-related protein Zm38-like | ||||
STRING | Pavir.J00444.1.p | 1e-159 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38620.1 | 6e-87 | myb domain protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.3NG032400.2.p |