PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG357500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 290aa    MW: 30210 Da    PI: 9.1451
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG357500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.35e-2957126372
                  TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                          g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl +a+++i++l+ ++++++ +
  Pavir.3KG357500.1.p  57 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDAAQHEIDKLPPLQFPPQAQ 126
                          78*************************************************************8888822 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.8E-2658119IPR005333Transcription factor, TCP
PROSITE profilePS5136929.68858116IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0031347Biological Processregulation of defense response
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:0009507Cellular Componentchloroplast
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MISGNLTNEE LAARCTKAEA PAAGAGAVVA KSPAVPSSRH WPPSTESRIV RVSRVFGGKD  60
RHSKVRTVKG LRDRRVRLSV PTAIQLYDLQ DRLGLSQPSK VVDWLLDAAQ HEIDKLPPLQ  120
FPPQAQGLVA HLPPSMVAPF ANGAADRAAA AANAATGASA AMADGDKRHC HGGIKGLMGF  180
NNSVGLVNGA MPLAHGLYYT PGGEPWANGN AVHDQVSHGT SPQTVAHHSP FSSLLSLAPG  240
PQLVFYSPEG GGFAMKEAAD HQFLGNLDHS EGQLSLSSAR SFLHPGSQG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A5e-2063117155Putative transcription factor PCF6
5zkt_B5e-2063117155Putative transcription factor PCF6
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.132220.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00326DAPTransfer from AT3G02150Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3KG357500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9563580.0EU956358.1 Zea mays clone 1561243 TCP family transcription factor containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-170transcription factor TCP13 isoform X1
RefseqXP_004961522.11e-170transcription factor TCP13 isoform X1
RefseqXP_012700333.11e-170transcription factor TCP13 isoform X1
TrEMBLK3Z8G31e-169K3Z8G3_SETIT; Uncharacterized protein
STRINGPavir.Ca01337.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.16e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5