PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.2NG581100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 254aa MW: 28626.5 Da PI: 9.5441 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.9 | 2e-31 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCdaeva+i+fs++g+lyeyss Pavir.2NG581100.1.p 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSTKGRLYEYSS 59 8***********************************************96 PP | |||||||
2 | K-box | 95.7 | 7.2e-32 | 86 | 172 | 12 | 98 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 a+++++ e+ +Lk +++ Lq++qR+llGe+L+sL++keLqqLeqqL++slk+iRs+Kn+l++ +i+elqkkek+l ++n L+k + Pavir.2NG581100.1.p 86 ADQANWGDEYGRLKTKLDALQKSQRQLLGEQLDSLTIKELQQLEQQLDSSLKHIRSRKNQLMFYSISELQKKEKSLTDQNGVLQKLM 172 67899***************************************************************************9998755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.0E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.156 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.65E-42 | 2 | 74 | No hit | No description |
SuperFamily | SSF55455 | 1.26E-32 | 2 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.6E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 3.5E-29 | 87 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.926 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFST KGRLYEYSSH 60 ESMEGILERY QRYSFEERAV LDPSIADQAN WGDEYGRLKT KLDALQKSQR QLLGEQLDSL 120 TIKELQQLEQ QLDSSLKHIR SRKNQLMFYS ISELQKKEKS LTDQNGVLQK LMEAEKEKNN 180 ALMNAHLREQ QNGASTSLPS PPLSTVPDSL PTLNIGPCQP RGGTVGESEP EPSPAQVNSG 240 KLPPWMLRSV SNR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-21 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.17794 | 0.0 | leaf| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269|PubMed:15299121}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:10814814}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.2NG581100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025800406.1 | 1e-174 | MADS-box transcription factor 18-like | ||||
Swissprot | A2YNI2 | 1e-138 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 1e-138 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | A0A1L5YFA1 | 0.0 | A0A1L5YFA1_PANVG; APL3 | ||||
STRING | Pavir.Ba00457.1.p | 0.0 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69120.1 | 1e-68 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.2NG581100.1.p |