PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.2NG415600.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 246aa MW: 27721 Da PI: 4.9176 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 176.1 | 9.5e-55 | 6 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L k + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgk Pavir.2NG415600.1.p 6 LPPGFRFHPTDEELVNYYLKRKIHGFKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGK 94 79****************************.99**************85335566888******************************** PP NAM 89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 d++vl+++g+ +g+kktLv+y+grap+g++tdWvmheyrl Pavir.2NG415600.1.p 95 DRRVLHHGGRPIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 134 **************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-64 | 4 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.215 | 6 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.4E-29 | 7 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG FKIELDIIPE VDLYKCEPWE LADKSFLPSR 60 DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVLH HGGRPIGMKK TLVYYRGRAP 120 QGVRTDWVMH EYRLDDKDAE DTLPIQDTYA LCRVFKKNAI CTEVDDLQAQ CSMALLEGAC 180 QQLLTSGSQE YQTPSPDVPV GSTSGGADDD ADKDESWMQF ISDDAWCSST ADGAEESTSC 240 VALAS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-52 | 1 | 159 | 12 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-52 | 1 | 159 | 12 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-52 | 1 | 159 | 12 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-52 | 1 | 159 | 12 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-52 | 1 | 159 | 15 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-52 | 1 | 159 | 12 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-52 | 1 | 159 | 12 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.2NG415600.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728059 | 0.0 | KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004957582.1 | 0.0 | NAC domain-containing protein 86 | ||||
Swissprot | Q9FFI5 | 2e-82 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A3L6T4V4 | 0.0 | A0A3L6T4V4_PANMI; Uncharacterized protein | ||||
TrEMBL | K4A2I7 | 0.0 | K4A2I7_SETIT; Uncharacterized protein | ||||
STRING | Pavir.Ba01384.1.p | 0.0 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3713 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G17730.1 | 1e-116 | NAC domain containing protein 57 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.2NG415600.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|