PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pavir.2NG261200.1.p

Organism

Panicum virgatum

Taxonomic ID

38727

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

G2-like

Protein Properties

Length: 256aa MW: 28161.5 Da PI: 5.4469

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.2NG261200.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	106.9	1.1e-33	75	129	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+r+rWtpeLHerFv+av+qLGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+ Pavir.2NG261200.1.p 75 KARMRWTPELHERFVDAVNQLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 129 68****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.241	72	132	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.5E-32	73	131	IPR009057	Homeodomain-like
SuperFamily	SSF46689	9.68E-18	74	129	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	4.5E-25	75	129	IPR006447	Myb domain, plants
Pfam	PF00249	9.4E-11	77	128	IPR001005	SANT/Myb domain
Pfam	PF14379	5.4E-22	161	205	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 256 aa Download sequence Send to blast
MYLTKQTEWW TELMNDDWKE IGDNPASAET QQVGPPAQSS ISVHQSATQQ TVSSQSGEPL 60 AVVAPSPSAG SNTAKARMRW TPELHERFVD AVNQLGGSEK ATPKGVLKLM KADNLTIYHV 120 KSHLQKYRTA RYRPELSEGS SEKKVASKED IPSIDLKGSF DLTEALRLQL ELQKRLHEQL 180 EIQRSLQLRI EEQGKCLQMM LEQQCIPGTE KATDASTSAE GSKLSSETPE PSAVKEVPET 240 SKNGPTKQTE SGDTQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	4e-32	74	133	1	60	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pvr.14269	0.0	callus\| leaf\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed throughout all stages of plant growth. {ECO:0000269\|PubMed:26082401}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves and fruits (PubMed:18263782). Expressed in the root cap and in the exodermis, sclerenchyma and vascular tissues of the root, in the cortex cells and the stele of lateral roots, in the mesophyll cells of the leaf, in pollen, vascular cylinder of the anther and the veins of the lemma, palea and pistils, and in all node I tissues (PubMed:26082401). {ECO:0000269\|PubMed:18263782, ECO:0000269\|PubMed:26082401}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250\|UniProtKB:Q6Z156}.
UniProt	Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269\|PubMed:18263782, ECO:0000269\|PubMed:19704822, ECO:0000269\|PubMed:20149131, ECO:0000269\|PubMed:24692424, ECO:0000269\|PubMed:25271318, ECO:0000269\|PubMed:25657119, ECO:0000269\|PubMed:26082401}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.2NG261200.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Not regulated by Pi starvation. {ECO:0000269\|PubMed:18263782, ECO:0000269\|PubMed:26082401}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT067745	0.0	BT067745.1 Zea mays full-length cDNA clone ZM_BFc0148N18 mRNA, complete cds.
GenBank	BT069467	0.0	BT069467.1 Zea mays full-length cDNA clone ZM_BFb0146B10 mRNA, complete cds.
GenBank	KJ726879	0.0	KJ726879.1 Zea mays clone pUT3420 G2-like transcription factor (GLK15) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025811239.1	1e-176	protein PHOSPHATE STARVATION RESPONSE 2-like
Swissprot	B8B5N8	1e-146	PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2
Swissprot	Q6Z156	1e-146	PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2
TrEMBL	A0A2T8JD20	1e-174	A0A2T8JD20_9POAL; Uncharacterized protein
STRING	Pavir.Bb01566.1.p	1e-176	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1971	37	89

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28610.1	4e-71	phosphate starvation response 1

Link Out ? help Back to Top
Phytozome	Pavir.2NG261200.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Wang C, et al. Involvement of OsSPX1 in phosphate homeostasis in rice. Plant J., 2009. 57(5): p. 895-904 [PMID:19000161] Zhang Q,Wang C,Tian J,Li K,Shou H Identification of rice purple acid phosphatases related to phosphate starvation signalling. Plant Biol (Stuttg), 2011. 13(1): p. 7-15 [PMID:21143719] Wu Z,Ren H,McGrath SP,Wu P,Zhao FJ Investigating the contribution of the phosphate transport pathway to arsenic accumulation in rice. Plant Physiol., 2011. 157(1): p. 498-508 [PMID:21715673] Chen J, et al. OsPHF1 regulates the plasma membrane localization of low- and high-affinity inorganic phosphate transporters and determines inorganic phosphate uptake and translocation in rice. Plant Physiol., 2011. 157(1): p. 269-78 [PMID:21753117] Wang C, et al. Functional characterization of the rice SPX-MFS family reveals a key role of OsSPX-MFS1 in controlling phosphate homeostasis in leaves. New Phytol., 2012. 196(1): p. 139-48 [PMID:22803610] Tian J, et al. Overexpression of OsPAP10a, a root-associated acid phosphatase, increased extracellular organic phosphorus utilization in rice. J Integr Plant Biol, 2012. 54(9): p. 631-9 [PMID:22805094] Shen C, et al. OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.). Plant Cell Environ., 2013. 36(3): p. 607-20 [PMID:22913536] Wu P,Shou H,Xu G,Lian X Improvement of phosphorus efficiency in rice on the basis of understanding phosphate signaling and homeostasis. Curr. Opin. Plant Biol., 2013. 16(2): p. 205-12 [PMID:23566853] Wang S, et al. Auxin response factor (OsARF12), a novel regulator for phosphate homeostasis in rice (Oryza sativa). New Phytol., 2014. 201(1): p. 91-103 [PMID:24111723] Shi J, et al. The paralogous SPX3 and SPX5 genes redundantly modulate Pi homeostasis in rice. J. Exp. Bot., 2014. 65(3): p. 859-70 [PMID:24368504] Li S,Wang C,Zhou L,Shou H Oxygen deficit alleviates phosphate overaccumulation toxicity in OsPHR2 overexpression plants. J. Plant Res., 2014. 127(3): p. 433-40 [PMID:24687599] Zhou Z, et al. SPX proteins regulate Pi homeostasis and signaling in different subcellular level. Plant Signal Behav, 2015. 10(9): p. e1061163 [PMID:26224365] Zhang K, et al. Down-regulation of OsSPX1 caused semi-male sterility, resulting in reduction of grain yield in rice. Plant Biotechnol. J., 2016. 14(8): p. 1661-72 [PMID:26806409] Cao Y, et al. Identification and expression analysis of OsLPR family revealed the potential roles of OsLPR3 and 5 in maintaining phosphate homeostasis in rice. BMC Plant Biol., 2016. 16(1): p. 210 [PMID:27716044]