PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG307200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 398aa    MW: 44396.9 Da    PI: 7.6642
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG307200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51141402128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                           pGfrFhPtdeelv +yLk+k+++k+l++ e i+++diyk++PwdLpk ++++eke+yf+++rd+ky+++ r+nr+t +g+Wkatg+d++
  Pavir.2KG307200.1.p  14 LPGFRFHPTDEELVGFYLKRKIQQKPLSI-ELIRQLDIYKYDPWDLPKLASTGEKELYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRP 102
                          69***************************.89***************88889999*********************************** PP

                  NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++s+ +++ +glkk+Lvfykgra kg ktdW+mheyr+
  Pavir.2KG307200.1.p 103 IYSSeGTKCIGLKKSLVFYKGRAAKGIKTDWMMHEYRM 140
                          ***956667***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.16E-5612171IPR003441NAC domain
PROSITE profilePS5100555.0313171IPR003441NAC domain
PfamPF023653.2E-2515140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDERADKDKS DEVLPGFRFH PTDEELVGFY LKRKIQQKPL SIELIRQLDI YKYDPWDLPK  60
LASTGEKELY FYCPRDRKYR NSARPNRVTG AGFWKATGTD RPIYSSEGTK CIGLKKSLVF  120
YKGRAAKGIK TDWMMHEYRM PSLNCPSLPK TPKDKNIPAN DAWAICRIFK KPSSVAQRVL  180
SHSWGPQSIA TTEPELLSAL QSIQASHFAL ESSSCSPNQY NSQHCLQGWQ QQKLNSSQDG  240
SSCKIINFNH SPSSPQLSEK YIHSSPIILP FGTQSPQKSS AITSVLLSMA PGIVNSMNEA  300
LPNTEMEQLE PSYGYTADWG IDTNGGIGNK DDDPYSRKPS NGFSSGIECG SQQKIKFPFD  360
LEVDSPDDWT SSMPCSLPCP PPPTEMSNSS STEKYYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-521517719171NO APICAL MERISTEM PROTEIN
1ut4_B8e-521517719171NO APICAL MERISTEM PROTEIN
1ut7_A8e-521517719171NO APICAL MERISTEM PROTEIN
1ut7_B8e-521517719171NO APICAL MERISTEM PROTEIN
4dul_A8e-521517719171NAC domain-containing protein 19
4dul_B8e-521517719171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed at globular stage onward in the COL progenitors after the first division of the hypophyseal cell. Later observed in these cells and their descendants, mostly in direct daughter cells. Also detected in the Epi/LRC stem cells and daughters, and is retained in maturing LRC layers. Present in elongated stem cells that are about to divide. {ECO:0000269|PubMed:19081078}.
UniprotTISSUE SPECIFICITY: Expressed in root cap stem cells and their immediate daughters. {ECO:0000269|PubMed:19081078}.
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2KG307200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025801988.10.0protein FEZ-like
SwissprotQ9ZVH02e-94FEZ_ARATH; Protein FEZ
TrEMBLA0A2T7ES970.0A0A2T7ES97_9POAL; Uncharacterized protein
STRINGPavir.Bb02181.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.12e-96NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]