PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.2KG306500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 90aa MW: 9972.25 Da PI: 7.9837 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 96.5 | 2.1e-30 | 18 | 76 | 1 | 60 |
ZF-HD_dimer 1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +++vrY eC++NhAas+Gg+++DGC+Ef+++ geegt +alkCaACgCHR+FHRr +++e Pavir.2KG306500.1.p 18 CCSVRYGECRRNHAASTGGYTIDGCREFIAE-GEEGTGTALKCAACGCHRSFHRRVQVYE 76 5789**************************8.999********************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 3.0E-25 | 1 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.7E-29 | 21 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.1E-22 | 22 | 71 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 24.501 | 23 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MKRLLIVRRC EPIVRFSCCS VRYGECRRNH AASTGGYTID GCREFIAEGE EGTGTALKCA 60 ACGCHRSFHR RVQVYEVAWD YGSDTSSTE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.2KG306500.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025799866.1 | 2e-57 | mini zinc finger protein 3-like | ||||
Swissprot | Q6ER22 | 1e-32 | MIF3_ORYSJ; Mini zinc finger protein 2 | ||||
TrEMBL | A0A1E5WMF4 | 1e-56 | A0A1E5WMF4_9POAL; Mini zinc finger protein 2 | ||||
STRING | Pavir.Bb02187.1.p | 4e-59 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-26 | mini zinc finger 2 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.2KG306500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|