PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.2KG137100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 146aa MW: 16476.7 Da PI: 8.3759 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56.4 | 4.1e-18 | 22 | 56 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C+tt T+lWR+gp g k+LCnaCGl+yr+kgl Pavir.2KG137100.1.p 22 CTQCHTTVTSLWRSGPFGRKSLCNACGLRYRRKGL 56 ********************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 2.42E-13 | 14 | 57 | No hit | No description |
PROSITE profile | PS50114 | 13.086 | 16 | 72 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 4.1E-13 | 16 | 68 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 4.7E-15 | 20 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 5.05E-13 | 21 | 55 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 22 | 47 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 3.8E-16 | 22 | 56 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MAVDPSCQKV VISLDQNKSK ICTQCHTTVT SLWRSGPFGR KSLCNACGLR YRRKGLEAQE 60 LEREEDKWKN TRRINRVRTR KVTELYENGD NRKKNPNEDQ EVAVSTTLTT IDCGNELMLK 120 QIEQHGEEAV TGAIILMDFT GTTLS* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.2KG137100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
STRING | Pavir.Ba03329.1.p | 9e-39 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP18253 | 8 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 5e-12 | GATA transcription factor 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.2KG137100.1.p |