PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG459200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 359aa    MW: 37929.1 Da    PI: 4.3965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG459200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.8e-171663148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         rg+WT++Ed +lv +++++G  +W++ ++  g+ R++k+c++rw +yl
  Pavir.1KG459200.1.p 16 RGSWTPQEDMRLVAYIQKHGHSNWRALPKQAGLLRCGKSCRLRWINYL 63
                         89******************************99************97 PP

2Myb_DNA-binding49.31.2e-1569114148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg++T eE+e + +++ +lG++ W++Ia++++ gRt++++k+ w+++l
  Pavir.1KG459200.1.p  69 RGNFTVEEEETIMRLHGMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.2271163IPR017930Myb domain
SuperFamilySSF466893.74E-3013110IPR009057Homeodomain-like
SMARTSM007178.3E-131565IPR001005SANT/Myb domain
PfamPF002493.2E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231770IPR009057Homeodomain-like
CDDcd001671.15E-101863No hitNo description
PROSITE profilePS5129424.57264118IPR017930Myb domain
SMARTSM007173.0E-1368116IPR001005SANT/Myb domain
PfamPF002493.8E-1469114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-2671118IPR009057Homeodomain-like
CDDcd001673.77E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLVAY IQKHGHSNWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETI MRLHGMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKKVAL  120
REQQQKAGAA TKNGAGAGTP VTDSSSASSS TTTTNNSSGG SDSGDQCGTS KEPDAAADAS  180
PLRDIDVWDM LVDAPAAAQP MLSSPCSSSS LTTCAGGAED LIELPVMDIE PDIWSIIDGE  240
GADGSGARHG DADATAPCTG AAAVSTSEAG EAVGDWWLED LEKELGLWGP TEDPLAQTDL  300
LVDHTGFGPL SDCNSEGDPV STYFQTGPHN AAAELQDVEL QLELELELEP SSSAALVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-27141182105C-Myb DNA-Binding Domain
1msf_C3e-27141182105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1KG459200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814304.11e-174myb-related protein Zm1-like
SwissprotP200241e-155MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A2S3GS791e-172A0A2S3GS79_9POAL; Uncharacterized protein
STRINGPavir.J10932.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.17e-67myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]