PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.T125000.1 | ||||||||
Common Name | POPTR_0004s11460g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 212aa MW: 24741.9 Da PI: 7.2524 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.2 | 9.1e-14 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+ll ++v G g+W++++r+ ++ +k+c++rw +yl Potri.T125000.1 13 KGPWTPEEDKLLSEYVSSNGEGRWSSVSRCSVLNFGGKSCRLRWVNYL 60 79******************************88889*********97 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 66 | 110 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++ Potri.T125000.1 66 RGQITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 110 7888******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.833 | 8 | 60 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.25E-29 | 10 | 107 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-11 | 12 | 62 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-12 | 13 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-19 | 14 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.43E-8 | 15 | 60 | No hit | No description |
PROSITE profile | PS51294 | 24.572 | 61 | 115 | IPR017930 | Myb domain |
SMART | SM00717 | 5.2E-14 | 65 | 113 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.9E-14 | 66 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 68 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-9 | 70 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MMGRGIAEQG WRKGPWTPEE DKLLSEYVSS NGEGRWSSVS RCSVLNFGGK SCRLRWVNYL 60 RPGLKRGQIT PQEEGIIIEL HALWGNKWST IARYLPGRTD NEIKNYWRTH FKKKDKSSQK 120 QEKRKALILE QEVQHHQQQQ QQLEAGEMKM VNTIDHVKMH EAQEMYFMYH NLEDQCSPVM 180 TQDVASWADF VVEDYYGLWG GLWNLDDHPQ G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 9e-24 | 13 | 114 | 27 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.T125000.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024454394.1 | 1e-146 | transcription factor MYB59-like | ||||
Swissprot | Q4JL84 | 2e-46 | MYB59_ARATH; Transcription factor MYB59 | ||||
Swissprot | Q9LX82 | 2e-46 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | A0A2K1R5X5 | 1e-157 | A0A2K1R5X5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0004s11460.1 | 1e-156 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1182 | 34 | 108 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30210.1 | 1e-67 | myb domain protein 121 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.T125000.1 |
Entrez Gene | 7463060 |
Publications ? help Back to Top | |||
---|---|---|---|
|