PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.T101400.1 | ||||||||
Common Name | POPTR_0017s06810g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 204aa MW: 23343.5 Da PI: 5.4096 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 65.3 | 6.5e-21 | 20 | 68 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ie+ksn qvtfskRr g+ KKA+ELS LC+a+va++ fs+ k++ + Potri.T101400.1 20 KQIEEKSNLQVTFSKRRGGLVKKASELSLLCGAQVAILAFSPGKKVFAF 68 68****************************************9999877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.348 | 12 | 72 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.0E-27 | 12 | 71 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.23E-26 | 13 | 86 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.29E-33 | 13 | 85 | No hit | No description |
PRINTS | PR00404 | 6.6E-20 | 14 | 34 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.0E-22 | 22 | 68 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-20 | 34 | 49 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.6E-20 | 49 | 70 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 204 aa Download sequence Send to blast |
MMMLNKRKKQ TQGRQKIEIK QIEEKSNLQV TFSKRRGGLV KKASELSLLC GAQVAILAFS 60 PGKKVFAFGH RDVDMVLDRY LTESSTAGEL GAASNDPQVQ QWNKEYEEAL KELEEEKKHV 120 AMAEQWNKVC ENNVNARFWW DEPIDDMELE ELEEYVRAME ELKKNVAARA NELTMANDHF 180 GNQNMSHHLD LGVHGFSLEN VLF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-16 | 13 | 110 | 1 | 87 | Myocyte-specific enhancer factor 2A |
5f28_A | 2e-16 | 13 | 114 | 2 | 92 | MEF2C |
5f28_B | 2e-16 | 13 | 114 | 2 | 92 | MEF2C |
5f28_C | 2e-16 | 13 | 114 | 2 | 92 | MEF2C |
5f28_D | 2e-16 | 13 | 114 | 2 | 92 | MEF2C |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.T101400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006372987.1 | 1e-150 | agamous-like MADS-box protein AGL62 | ||||
Refseq | XP_024448636.1 | 1e-150 | agamous-like MADS-box protein AGL62 | ||||
TrEMBL | U5FKM8 | 1e-148 | U5FKM8_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0017s06810.1 | 1e-142 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF128 | 33 | 331 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 2e-35 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.T101400.1 |
Entrez Gene | 18107011 |