PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.019G077200.3 | ||||||||
Common Name | POPTR_0019s10580g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 225aa MW: 25580.2 Da PI: 9.927 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.5 | 1.3e-31 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ Potri.019G077200.3 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 58 79***********************************************8 PP | |||||||
2 | K-box | 106.6 | 2.9e-35 | 77 | 174 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 +s+ +s +e +a+++qqe+akL+++i++Lq+++Rhl+G+ +++Ls+keL+qLe++Le+++++iRskK+elll++ie+lqk+e el++e + Potri.019G077200.3 77 SSNASSITEINAQYYQQESAKLRQQIQMLQNSNRHLMGDAVSNLSVKELKQLENRLERGITRIRSKKHELLLAEIEYLQKREIELENESVC 167 4445559999********************************************************************************* PP K-box 94 Lrkklee 100 Lr+k++e Potri.019G077200.3 168 LRTKIAE 174 ****986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.1E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 34.16 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.42E-42 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 1.01E-32 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.9E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.6E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-26 | 87 | 172 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.395 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 225 aa Download sequence Send to blast |
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYANN 60 NSIRSTIDRY KKASSDSSNA SSITEINAQY YQQESAKLRQ QIQMLQNSNR HLMGDAVSNL 120 SVKELKQLEN RLERGITRIR SKKHELLLAE IEYLQKREIE LENESVCLRT KIAEVERLQQ 180 ANMVTGAELN AIQALAASRN FFAPHLLEGG TAYPHNDKKI LHLG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_R | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
1tqe_S | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_A | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_B | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_C | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_D | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_E | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
6c9l_F | 6e-21 | 1 | 64 | 1 | 64 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.12882 | 0.0 | bud| catkin |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and seeds (Ref.1). Expressed in endotesta cell layer of developing seeds (PubMed:28369525). {ECO:0000269|PubMed:28369525, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.019G077200.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006371450.1 | 1e-163 | agamous-like MADS-box protein AGL11 isoform X3 | ||||
Refseq | XP_011031534.1 | 1e-163 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X1 | ||||
Refseq | XP_011031535.1 | 1e-163 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X2 | ||||
Refseq | XP_011031536.1 | 1e-163 | PREDICTED: agamous-like MADS-box protein AGL11 isoform X3 | ||||
Refseq | XP_024447125.1 | 1e-163 | agamous-like MADS-box protein AGL11 isoform X1 | ||||
Swissprot | F6I457 | 1e-138 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | U5FIJ5 | 1e-162 | U5FIJ5_POPTR; Uncharacterized protein | ||||
STRING | cassava4.1_021818m | 1e-147 | (Manihot esculenta) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.1 | 1e-112 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.019G077200.3 |
Entrez Gene | 7475776 |