PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.019G018200.1 | ||||||||
Common Name | POPTR_0019s03490g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 189aa MW: 21687.7 Da PI: 10.1177 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.6 | 6e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv +++ +G g+W++ ++ g+ R++k+c++rw +yl Potri.019G018200.1 14 KGPWTPEEDQILVSYIRSYGHGNWRALPKQAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 55 | 1.9e-17 | 67 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE+e ++++++ lG++ W++Ia++++ gRt++++k++w+++l Potri.019G018200.1 67 RGNFSNEEEETIIKLHQILGNR-WSAIAARLPAGRTDNEIKNYWHSHL 113 89********************.**********************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 24.582 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.21E-29 | 10 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.65E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.6E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-16 | 66 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.413 | 66 | 117 | IPR017930 | Myb domain |
Pfam | PF00249 | 5.0E-16 | 67 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.42E-11 | 69 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MGRAPCCEMM GLKKGPWTPE EDQILVSYIR SYGHGNWRAL PKQAGLLRCG KSCRLRWINY 60 LRPDIKRGNF SNEEEETIIK LHQILGNRWS AIAARLPAGR TDNEIKNYWH SHLKKRFQQN 120 MGRPTEHCRK TPERAMVNNT SSSQPASFKV HQSKCQRQSP SDNAPIFQEA SSQEMFSSMA 180 TMEAMNGFS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-28 | 12 | 118 | 5 | 109 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Fades out in old roots and leaves. {ECO:0000269|PubMed:24415840}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in imbibed seeds, hypocotyls, cotyledons, roots, seedlings, siliques and flowers. {ECO:0000269|PubMed:24415840}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. | |||||
UniProt | Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269|PubMed:17015446, ECO:0000269|PubMed:19161942}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.019G018200.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269|PubMed:19161942}. | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024447113.1 | 1e-141 | transcription factor MYB4 | ||||
Swissprot | Q7XBH4 | 5e-73 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
Swissprot | Q9LTC4 | 6e-73 | MYB15_ARATH; Transcription factor MYB15 | ||||
Swissprot | Q9SJX8 | 4e-73 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A3N7G7Y5 | 1e-140 | A0A3N7G7Y5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0019s03490.1 | 1e-135 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-75 | myb domain protein 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.019G018200.1 |
Entrez Gene | 7465941 |