PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.018G049000.1 | ||||||||
Common Name | POPTR_0018s08500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 183aa MW: 21061.1 Da PI: 9.5487 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59 | 1e-18 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G+++W++Ia++ ++R++k+c++rw ++l Potri.018G049000.1 17 KGAWTAEEDQKLARVIEIHGPKRWRSIAAKADLNRCGKSCRLRWMNHL 64 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.4E-23 | 9 | 67 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.136 | 12 | 68 | IPR017930 | Myb domain |
SMART | SM00717 | 4.9E-16 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-17 | 17 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.04E-24 | 18 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.46E-11 | 19 | 64 | No hit | No description |
PROSITE profile | PS50090 | 5.819 | 65 | 97 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-11 | 68 | 97 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3 | 69 | 107 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MPLAPRRSKC GKKEANKGAW TAEEDQKLAR VIEIHGPKRW RSIAAKADLN RCGKSCRLRW 60 MNHLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIADNKK IKQKEEKPVI ISTLKQPEPE 120 KSNVLGMDNI AKGREEGTSK RLEDSKSSFV GDDFFDFSNE DPVNLEWMSK FLELEESLYE 180 FP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-20 | 17 | 96 | 4 | 82 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.018G049000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FR828544 | 6e-40 | FR828544.1 Rosa rugosa mRNA for putative MYB transcription factor (myb11 gene). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011010380.1 | 1e-120 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | P10290 | 3e-36 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A2K1WW01 | 1e-130 | A0A2K1WW01_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0018s08500.1 | 1e-124 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 3e-37 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.018G049000.1 |
Entrez Gene | 7476676 |