PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.016G125700.1 | ||||||||
Common Name | POPTR_0016s13350g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | BES1 | ||||||||
Protein Properties | Length: 164aa MW: 18594.9 Da PI: 8.3769 | ||||||||
Description | BES1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF822 | 124.2 | 1.7e-38 | 34 | 126 | 3 | 95 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 + r p+ +Er n++RERrRRa+a ki+ GLR++Gnyklpk+aD n+ lkALc+eAGw+ve+DGt r + + +++ + ss +aspe Potri.016G125700.1 34 KFRYPSDRERQTNQQRERRRRAVAKKIFEGLRKHGNYKLPKHADSNDLLKALCEEAGWLVEEDGTICRMVLHNPYHEANVASSYDASPEDH 124 5699****************************************************************88888866667777777777665 PP DUF822 94 lq 95 Potri.016G125700.1 125 NY 126 44 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05687 | 1.2E-34 | 35 | 127 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MVDEKKVVLS GCIKTSRGPW RVHRATKDGR IVTKFRYPSD RERQTNQQRE RRRRAVAKKI 60 FEGLRKHGNY KLPKHADSND LLKALCEEAG WLVEEDGTIC RMVLHNPYHE ANVASSYDAS 120 PEDHNYCTCN NHLDSEYGAF PLSTSSPIQE CHGGNDVNLI LSL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zd4_A | 1e-14 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 1e-14 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 1e-14 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 1e-14 | 36 | 101 | 372 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitously expressed in cotyledons, leaves, hypocotyls and roots. {ECO:0000269|PubMed:12007405}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Positive regulator of brassinosteroid (BR) signaling. Transcription factor that activates target gene expression by binding specifically to the DNA sequence 5'-CANNTG-3'(E box) through its N-terminal domain. Can bind individually to the promoter as a homodimer or synergistically as a heterodimer with BIM1, BIM2 or BIM3. The C-terminal domain is probably involved in transcriptional activation (PubMed:12007405, PubMed:15680330, PubMed:18467490, PubMed:19170933). Recruits the transcription elongation factor IWS1 to control BR-regulated gene expression (PubMed:20139304). Forms a trimeric complex with IWS1 and ASHH2/SDG8 to regulate BR-regulated gene expression (PubMed:24838002). Promotes quiescent center (QC) self-renewal by cell divisions in the primary root. Binds to the E-boxes of the BRAVO promoter to repress its expression (PubMed:24981610). {ECO:0000269|PubMed:12007405, ECO:0000269|PubMed:15680330, ECO:0000269|PubMed:18467490, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20139304, ECO:0000269|PubMed:24838002, ECO:0000269|PubMed:24981610}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.016G125700.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011046810.1 | 1e-114 | PREDICTED: protein BRASSINAZOLE-RESISTANT 2-like | ||||
Swissprot | Q9LN63 | 1e-17 | BZR2_ARATH; Protein BRASSINAZOLE-RESISTANT 2 | ||||
TrEMBL | B9IGH5 | 1e-120 | B9IGH5_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0016s13350.1 | 1e-121 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15152 | 11 | 13 | Representative plant | OGRP10084 | 10 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G19350.6 | 5e-20 | BES1 family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.016G125700.1 |
Entrez Gene | 7460400 |